DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3356 and HERC3

DIOPT Version :9

Sequence 1:NP_611896.1 Gene:CG3356 / 37876 FlyBaseID:FBgn0034989 Length:1122 Species:Drosophila melanogaster
Sequence 2:NP_055421.1 Gene:HERC3 / 8916 HGNCID:4876 Length:1050 Species:Homo sapiens


Alignment Length:786 Identity:186/786 - (23%)
Similarity:309/786 - (39%) Gaps:174/786 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly   427 SGELSVKERECLLESIAILNETERVDF-IVQQLDPHIENTHLIYALCEICHNLMIYNKHAVFE-- 488
            ||:||.:              .:|..: ||:|:....:.|   :.||....|   |:....|.  
Human   349 SGQLSAR--------------ADRFKYHIVKQIFSGGDQT---FVLCSKYEN---YSPAVDFRTM 393

  Fly   489 YKLLYTLAFTPKFIRAVW-FKLAAESTQLGFSAPLTLISKGVV-----------------PKHQG 535
            .:..||.....:.| ||| .||:..:.....:..:.::|....                 ||..|
Human   394 NQAHYTSLINDETI-AVWRQKLSEHNNANTINGVVQILSSAACWNGSFLEKKIDEHFKTSPKIPG 457

  Fly   536 VDRTIPLLATFCMLFGRLLPTLHDVEFVENKLLLQVHSTINHVRLMPFSIAEIIQMSKTLKDISM 600
            :|                   |:....:..||:...||.|....|..|....|.|:|.:..|:..
Human   458 ID-------------------LNSTRVLFEKLMNSQHSMILEQILNSFESCLIPQLSSSPPDVEA 503

  Fly   601 GLVELAFPE---------------------TRSNLANYRKVLGH--TEADDK------------- 629
            ..:.|..||                     .|.: .|..|||.:  ::...|             
Human   504 MRIYLILPEFPLLQDSKYYITLTIPLAMAILRLD-TNPSKVLDNWWSQVCPKYFMKLVNLYKGAV 567

  Fly   630 --KLRHQKQ-----IWANLLNVVVFVLNQIHTRDLRLGFCPEDHWTVTRLDLPLDRPTD--LPLT 685
              .||.:|.     ::.|.:...:.:|.:::..:|::.....|.:.:..:...:|...|  :...
Human   568 LYLLRGRKTFLIPVLFNNYITAALKLLEKLYKVNLKVKHVEYDTFYIPEISNLVDIQEDYLMWFL 632

  Fly   686 HSSRLRGIRPFQPIRDFTREDFENGPPMSTKQIRSITILREIPFVVPFNKRVSILQSLVAASKMR 750
            |.:.::. ||                    ..|:....|...||:.....:..:||: .|..:|:
Human   633 HQAGMKA-RP--------------------SIIQDTVTLCSYPFIFDAQAKTKMLQT-DAELQMQ 675

  Fly   751 VQ---GNMQ-AFL---------QGPSVLITVRRSHLYEDAYDKLRPDNEPDLRFKFRIQFVSSLG 802
            |.   .|:| .|:         :.|.:::.|||::|..||..:|...::.||:...::.|..   
Human   676 VAVNGANLQNVFMLLTLEPLLARSPFLVLHVRRNNLVGDALRELSIHSDIDLKKPLKVIFDG--- 737

  Fly   803 LDEAGIDGGGVFREFLSELIKTAFDPNRGFFMVTTDNKLYPNPNVADLFED--YEKHYYF--IGR 863
              |..:|.|||.:||...|:|...:|..|.|....|:.|.       .|.|  :.:|.:|  ||.
Human   738 --EEAVDAGGVTKEFFLLLLKELLNPIYGMFTYYQDSNLL-------WFSDTCFVEHNWFHLIGI 793

  Fly   864 ILGKSIYENLLVEL--PLAEFFLTKLAGKYSDV--DIHQLASLDPELYRNLLYLKDYSG-DVSE- 922
            ..|.:||.:.:|:|  |||      |..|..:|  .:..|..|.|...|:|..|.||.| ||.| 
Human   794 TCGLAIYNSTVVDLHFPLA------LYKKLLNVKPGLEDLKELSPTEGRSLQELLDYPGEDVEET 852

  Fly   923 LNLDFTVASSSLGQTQIVELKPQGQSIPVTNSNRIEYLQLIADYKLNVQIRRHCNAFRKGLSNVL 987
            ..|:||:...|.|..:..:|.|.|.::.|...||.|::....:|...:.:.....||..|...|.
Human   853 FCLNFTICRESYGVIEQKKLIPGGDNVTVCKDNRQEFVDAYVNYVFQISVHEWYTAFSSGFLKVC 917

  Fly   988 PIEWLYMFSNKELQILISGAEIPIDLEDLKKHCEYGGEFSPEHPSIVTFWEVLEGFDDMQRRQLL 1052
            ..:.|.:|...||:.::.| ....:.|:|::...|.|::|..||::..|||....|...::::.|
Human   918 GGKVLELFQPSELRAMMVG-NSNYNWEELEETAIYKGDYSATHPTVKLFWETFHEFPLEKKKKFL 981

  Fly  1053 KFVTSCSRPPLLGFKDLDPPFFIQNTGDMER-LPTASTCTNLLKLPPFKTVEQMREKLLYAIQSG 1116
            .|:|...|.|:.|...|.  ..||:|...|. ||.|.||.|||.||.:.:.|.:..:|..|:.:.
Human   982 LFLTGSDRIPIYGMASLQ--IVIQSTASGEEYLPVAHTCYNLLDLPKYSSKEILSARLTQALDNY 1044

  Fly  1117 AGFELS 1122
            .||.|:
Human  1045 EGFSLA 1050

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3356NP_611896.1 HECTc 766..1120 CDD:238033 111/364 (30%)
HECTc 788..1119 CDD:214523 103/341 (30%)
HERC3NP_055421.1 RCC1 1 1..51
ATS1 2..331 CDD:227511
RCC1 2 52..101
RCC1 3 102..154
RCC1 4 156..207
RCC1 5 208..259
RCC1 6 261..311
RCC1 313..377 CDD:366085 9/44 (20%)
RCC1 7 313..366 7/30 (23%)
HECTc 702..1048 CDD:238033 111/366 (30%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5021
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.