DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3356 and RSP5

DIOPT Version :9

Sequence 1:NP_611896.1 Gene:CG3356 / 37876 FlyBaseID:FBgn0034989 Length:1122 Species:Drosophila melanogaster
Sequence 2:NP_011051.3 Gene:RSP5 / 856862 SGDID:S000000927 Length:809 Species:Saccharomyces cerevisiae


Alignment Length:452 Identity:133/452 - (29%)
Similarity:225/452 - (49%) Gaps:59/452 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly   710 GPPMSTKQIRSITILREIP-------------FVVPFNKRV---------SILQSLVAASKMRVQ 752
            ||..:|.|.:.::.|..:|             :.|..|.:.         |.|...|...|...:
Yeast   372 GPTNTTIQQQPVSQLGPLPSGWEMRLTNTARVYFVDHNTKTTTWDDPRLPSSLDQNVPQYKRDFR 436

  Fly   753 GNMQAFLQGPSVL-------ITVRRSHLYEDAYDKLRPDNEPDLRFKFRIQFVSSLGLDEAGIDG 810
            ..:..|...|::.       |.|||.:::||||.::......||:.:..|:|..     |.|:|.
Yeast   437 RKVIYFRSQPALRILPGQCHIKVRRKNIFEDAYQEIMRQTPEDLKKRLMIKFDG-----EEGLDY 496

  Fly   811 GGVFREFLSELIKTAFDPNRGFFMVTT-DN-KLYPNPNVADLFEDYEKHYYFIGRILGKSIYENL 873
            |||.|||...|....|:|....|..:. || .:..||| :.:..::..::.||||::|..::...
Yeast   497 GGVSREFFFLLSHEMFNPFYCLFEYSAYDNYTIQINPN-SGINPEHLNYFKFIGRVVGLGVFHRR 560

  Fly   874 LVELPLAEFFLTKLAGKY-----SDVDIHQLASLDPELYRNLLYLKDYSGDVSELNLDFTVASSS 933
            .::    .||:..|   |     ..|.:..:..:|.|:|.:|.::.:.|.| ..|:|.|:.....
Yeast   561 FLD----AFFVGAL---YKMMLRKKVVLQDMEGVDAEVYNSLNWMLENSID-GVLDLTFSADDER 617

  Fly   934 LGQTQIVELKPQGQSIPVTNSNRIEYLQLIADYKLNVQIRRHCNAFRKGLSNVLPIEWLYMFSNK 998
            .|:...|:|||.|::|.||:.|:.||::|...:::..:::....||..|.:.::|.:.:.:|..:
Yeast   618 FGEVVTVDLKPDGRNIEVTDGNKKEYVELYTQWRIVDRVQEQFKAFMDGFNELIPEDLVTVFDER 682

  Fly   999 ELQILISG-AEIPIDLEDLKKHCEYGGEFSPEHPSIVTFWEVLEGFDDMQRRQLLKFVTSCSRPP 1062
            ||::||.| ||  ||:||.|||.:|.| :......|..||:.:..:|:.||.:||:|.|..||.|
Yeast   683 ELELLIGGIAE--IDIEDWKKHTDYRG-YQESDEVIQWFWKCVSEWDNEQRARLLQFTTGTSRIP 744

  Fly  1063 LLGFKDL---DPP--FFIQNTGDMERLPTASTCTNLLKLPPFKTVEQMREKLLYAIQSGAGF 1119
            :.|||||   |.|  |.|:..|::::||.:.||.|.:.||.:...:.|::||..|::...||
Yeast   745 VNGFKDLQGSDGPRRFTIEKAGEVQQLPKSHTCFNRVDLPQYVDYDSMKQKLTLAVEETIGF 806

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3356NP_611896.1 HECTc 766..1120 CDD:238033 119/367 (32%)
HECTc 788..1119 CDD:214523 109/343 (32%)
RSP5NP_011051.3 HUL4 3..809 CDD:227354 133/452 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5021
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.