DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3356 and Nedd4l

DIOPT Version :9

Sequence 1:NP_611896.1 Gene:CG3356 / 37876 FlyBaseID:FBgn0034989 Length:1122 Species:Drosophila melanogaster
Sequence 2:XP_036017204.1 Gene:Nedd4l / 83814 MGIID:1933754 Length:1261 Species:Mus musculus


Alignment Length:499 Identity:151/499 - (30%)
Similarity:247/499 - (49%) Gaps:68/499 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly   665 DH------WTVTRLDLPLD-------RPTDL-PL-----------------THSSRL----RGIR 694
            ||      |...||..|:.       .|.|| ||                 .|||::    ...|
Mouse   785 DHNTKTTTWEDPRLKFPVHMRSKASLNPNDLGPLPPGWEERIHLDGRTFYIDHSSQVLCGENDTR 849

  Fly   695 PFQPIRDFTREDFENGPPMSTKQIRSITILREIPFVVPFNKRVSILQSLVAASKMRVQGNMQAFL 759
            ...|:.|.....:|: |.:....|..    ..:|:...|.::....:     .|::...::....
Mouse   850 ESVPLYDSKITQWED-PRLQNPAITG----PAVPYSREFKQKYDYFR-----KKLKKPADIPNRF 904

  Fly   760 QGPSVLITVRRSHLYEDAYDKLRPDNEPD-LRFKFRIQFVSSLGLDEAGIDGGGVFREFLSELIK 823
            :     :.:.|::::|::|.::.....|| |:.:..|:|.|     |.|:|.|||.||:...|.|
Mouse   905 E-----MKLHRNNIFEESYRRIMSVKRPDVLKARLWIEFES-----EKGLDYGGVAREWFFLLSK 959

  Fly   824 TAFDPNRGFFMVT-TDN-KLYPNPNVADLFEDYEKHYYFIGRILGKSIYENLLVELPLAEFFLTK 886
            ..|:|..|.|..: ||| .|..|||.....||:..::.||||:.|.:::...|::......|...
Mouse   960 EMFNPYYGLFEYSATDNYTLQINPNSGLCNEDHLSYFTFIGRVAGLAVFHGKLLDGFFIRPFYKM 1024

  Fly   887 LAGKYSDVDIHQLASLDPELYRNLLYLKDYSGDVSELNLDFTVASSSLGQTQIVELKPQGQSIPV 951
            :.||  .:.::.:.|:|.|.|.:|.::.:  .|.:||:|.|.:...:.|||..|:|||.|..|.|
Mouse  1025 MLGK--QITLNDMESVDSEYYNSLKWILE--NDPTELDLMFCIDEENFGQTYQVDLKPNGSEIMV 1085

  Fly   952 TNSNRIEYLQLIADYKLNVQIRRHCNAFRKGLSNVLPIEWLYMFSNKELQILISGAEIPIDLEDL 1016
            ||.|:.||:.|:..::...::::..|||.:|.:.:|||:.:.:|...||::|:.|.. .:|:.|.
Mouse  1086 TNENKREYIDLVIQWRFVNRVQKQMNAFLEGFTELLPIDLIKIFDENELELLMCGLG-DVDVNDW 1149

  Fly  1017 KKHCEYGGEFSPEHPSIVTFWEVLEGFDDMQRRQLLKFVTSCSRPPLLGFKDL----DPPFF-IQ 1076
            ::|..|...:.|.||.|..||:.:...|..:|.:||:|||..||.|:.||.:|    .|..| |:
Mouse  1150 RQHSIYKNGYCPNHPVIQWFWKAVLLMDAEKRIRLLQFVTGTSRVPMNGFAELYGSNGPQLFTIE 1214

  Fly  1077 NTGDMERLPTASTCTNLLKLPPFKTVEQMREKLLYAIQSGAGFE 1120
            ..|..|:||.|.||.|.|.|||::|.|.:|||||.|:::..|||
Mouse  1215 QWGSPEKLPRAHTCFNRLDLPPYETFEDLREKLLMAVENAQGFE 1258

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3356NP_611896.1 HECTc 766..1120 CDD:238033 126/361 (35%)
HECTc 788..1119 CDD:214523 121/338 (36%)
Nedd4lXP_036017204.1 PHA03378 <107..318 CDD:223065
C2 <367..420 CDD:417471
WW 465..491 CDD:395320
WW 655..684 CDD:395320
WW 768..798 CDD:238122 3/12 (25%)
WW 817..867 CDD:197736 10/50 (20%)
HECTc 928..1257 CDD:214523 121/338 (36%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5021
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.