DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment CG3356 and MAGIX

DIOPT Version :9

Sequence 1:	NP_611896.1	Gene:	CG3356 / 37876	FlyBaseID:	FBgn0034989	Length:	1122	Species:	Drosophila melanogaster
Sequence 2:	NP_079135.3	Gene:	MAGIX / 79917	HGNCID:	30006	Length:	334	Species:	Homo sapiens

Alignment Length:	120	Identity:	27/120 - (22%)
Similarity:	46/120 - (38%)	Gaps:	32/120 - (26%)

- Green bases have known domain annotations that are detailed below.

  Fly   671 RLDLPLDRPTDLPLTHSSRLRGIR-------PFQPIRDFTREDFENGPPMSTKQIRSITILREIP 728
            :|.|.:.||.:   ||..:.||:.       |..|    .|.....||.::..:..|.::::..|
Human   200 QLHLVIRRPLE---THPGKPRGVGEPRKGVVPSWP----DRSPDPGGPEVTGSRSSSTSLVQHPP 257

  Fly   729 FVVPFNKRVSILQSLVAASKMR--VQGNMQAFLQGPSVLITVRRSHLYEDAYDKL 781
                         |.....|.|  .:.:.:|...||:|....||:   ||..|::
Human   258 -------------SRTTLKKTRGSPEPSPEAAADGPTVSPPERRA---EDPNDQI 296

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
CG3356	NP_611896.1	HECTc	766..1120	CDD:238033	5/16 (31%)
CG3356	NP_611896.1	HECTc	788..1119	CDD:214523
MAGIX	NP_079135.3	Disordered. /evidence=ECO:0000256\|SAM:MobiDB-lite	1..26
		PDZ_signaling	124..206	CDD:238492	2/5 (40%)
		Disordered. /evidence=ECO:0000256\|SAM:MobiDB-lite	209..306		23/111 (21%)
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	1	0.900	-	-		E1_COG5021
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
Isobase	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	0	0.000	Not matched by this tool.
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
User_Submission	0	0.000	Not matched by this tool.
	1	0.900