DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3356 and herc5.2

DIOPT Version :9

Sequence 1:NP_611896.1 Gene:CG3356 / 37876 FlyBaseID:FBgn0034989 Length:1122 Species:Drosophila melanogaster
Sequence 2:XP_005160175.1 Gene:herc5.2 / 794323 ZFINID:ZDB-GENE-090311-16 Length:987 Species:Danio rerio


Alignment Length:595 Identity:149/595 - (25%)
Similarity:243/595 - (40%) Gaps:107/595 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly   548 MLFGRLLPTLHDVEFVE-NKLL----LQVHSTINHVRLMPFSIAEIIQM--SKTLKDISMGLVEL 605
            :|...|:..|...:..| ||.|    ||::|          :..|:::|  ||...|....||:|
Zfish   462 LLLPELIKGLEQYQRSELNKALASKILQLNS----------AAREMLEMFWSKLPDDWLKSLVKL 516

  Fly   606 AFPETRSNLANYRKVLGHTEADDKKLRHQKQIWANLLNVVVFVLNQIHTRDLRLGF--CPEDHWT 668
             |.:..::|.:|..|.    |.|..|:|.:    |||.:            |::.:  |...|..
Zfish   517 -FHKESADLIDYMSVC----AMDSDLKHLQ----NLLRI------------LQMAYKVCCSTHRD 560

  Fly   669 VTRLDLPLDRPTDLPLTHSSRLRGIRPFQPIRDFT-----REDFENGPPMSTKQIRSITILREIP 728
            :|..|..:...:||.....:.:..:..:.|..|:.     |:.|          |:::.||.:.|
Zfish   561 ITISDFIIYEISDLLNALQATIDDLADWDPFVDYVYMMKLRDYF----------IKTLEILVKFP 615

  Fly   729 FVVPFNKRVSILQSL----VAASKMRVQGNMQAFLQGPSVLITVRRSHLYEDAYDKLRPDNEPDL 789
            ||..:..:..|...|    :..|..|..||      ....::.:.|..|..|....|| .|....
Zfish   616 FVADYASKRGIFNHLEIKMIRRSSNRFLGN------ATFNVLHINRESLLMDTLKYLR-QNTHSF 673

  Fly   790 RFKFRIQFVSSLGLDEAGIDGGGVFREFLSELIKTAFDPNRGFFMVTTDNKLYPNPNVADLFEDY 854
            ....|:.|:.     |.|||..|:..||.|.:.|:....::....|...:.::.||:    ....
Zfish   674 SHLSRVAFIG-----EDGIDMRGLSAEFFSLISKSFLKWDKKILEVHPSSLVWFNPH----HTRG 729

  Fly   855 EKHYYFIGRILGKSIY--ENLLVELPLAEFFLTKLAGKYSDVDIHQLASLDPELYRNLLYLKDYS 917
            .|::|::|.|.|.::|  .::.::.||| .|...|..|.|..|:.:|:.::....:||  ||:..
Zfish   730 NKNFYYLGVICGMALYNRHHINIDFPLA-LFKKLLQQKPSLDDLEELSPVEARSLKNL--LKEDE 791

  Fly   918 GDVSELNLDFTVASSSLGQTQIVELKPQGQSIPVTNSNRIEYLQLIADYKLNVQIRRHCNAFRKG 982
            ..|..|.|||||...        ||.|.|..|.|...||.:|:.|..|:..|..::.....|.:|
Zfish   792 EVVDLLFLDFTVKGH--------ELVPNGSQIQVNKVNRQKYVDLYVDFVFNKSVKTQFEQFTRG 848

  Fly   983 LSNVLPIEWLYMFSNKELQILISGAEIPIDLEDLKKHCEYGGEFSPEHPSIVTFWEVLEGFDDMQ 1047
            .|...|::...||..:|||.|:.|:. ..:.::.::...|.| .|.....|..||.|.....:..
Zfish   849 FSKGCPLDAWTMFHPEELQELLHGSP-QYNWKEFQQSASYEG-CSASDELIKNFWTVFFELSEEH 911

  Fly  1048 RRQLLKFVTSCSRPPLLGF---------KDLDPPFFIQNTGDMERLPTASTCTNLLKLPPFKTVE 1103
            :::.|.|:....|.|..||         :|...|        .:.||.|.||...|.||.:..:.
Zfish   912 KKKFLMFLYGTERVPAGGFSKRRIKISTRDCPDP--------DDHLPKAQTCFGRLVLPKYTDIN 968

  Fly  1104 QMREKLLYAI 1113
            .:|.||.:||
Zfish   969 TLRNKLTHAI 978

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3356NP_611896.1 HECTc 766..1120 CDD:238033 97/359 (27%)
HECTc 788..1119 CDD:214523 91/337 (27%)
herc5.2XP_005160175.1 RCC1_2 120..149 CDD:290274
RCC1 136..186 CDD:278826
RCC1 189..238 CDD:278826
RCC1 242..290 CDD:278826
RCC1 296..347 CDD:278826
HECTc 649..985 CDD:294058 97/361 (27%)
HECTc 678..984 CDD:214523 91/331 (27%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5021
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.