DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3356 and Herc4

DIOPT Version :9

Sequence 1:NP_611896.1 Gene:CG3356 / 37876 FlyBaseID:FBgn0034989 Length:1122 Species:Drosophila melanogaster
Sequence 2:NP_084390.1 Gene:Herc4 / 67345 MGIID:1914595 Length:1057 Species:Mus musculus


Alignment Length:668 Identity:176/668 - (26%)
Similarity:285/668 - (42%) Gaps:113/668 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly   507 FKLAAESTQLGFSAPLTLISKGVVPKHQGVDRTIPLLATFCMLFGRLLP----TLHDVEFVENKL 567
            ::.....:.:..:|...|..|.:.|.|..:.:.:.     ..|...|:|    :|.|||      
Mouse   449 YRTGTRFSGVDMNAARLLFHKLIQPDHPQISQQVA-----ASLEKNLIPKLTSSLPDVE------ 502

  Fly   568 LLQVHSTINHVRLM-----------PFSIAEIIQMSKT-LK-----------DISMGLVELAFPE 609
            .|:.:.|:....||           ||..| ::.:.|. ||           .:.:.:||| |.|
Mouse   503 ALRFYLTLPECPLMSDCNNFTTIAIPFGTA-LVNLEKAPLKVLENWWSVLEPPLFLKIVEL-FKE 565

  Fly   610 TRSNLANYRKVLGHTEADDKKLRHQKQIWANLLNVVVFVLNQIHTRDLRLG-FCPEDHWTVTRLD 673
            ...:|....|: |...:       :::|:.:.|:..:.||..:|..:.:.| ....|.:.:..:.
Mouse   566 VVVHLLKLYKI-GIPPS-------ERRIFNSFLHTALKVLEILHRVNEKTGQLIQYDKFYIHEVQ 622

  Fly   674 LPLDRPTDLPLTHSSRLRGIRPFQPIRDFTREDFENGPPMSTKQIRSITILREIPFVV---PF-- 733
            ..:|...|.......:..|:            |..:|          :|.|.:||..:   ||  
Mouse   623 ELIDIRNDYINWVQQQAYGV------------DVSHG----------VTELADIPVTICTYPFVF 665

  Fly   734 --------NKRVSILQSLVAASKMRVQGNMQAFLQ-----GPSVLITVRRSHLYEDAYDKLRPDN 785
                    .:..::||..:|..:...|.....||.     .|.:::.|||.::..||.:.||...
Mouse   666 DAQAKTTLLQTDAVLQMQMAIDQAHRQNVSSLFLPVIESVNPCLILVVRRENIVGDAMEVLRKTK 730

  Fly   786 EPDLRFKFRIQFVSSLGLDEAGIDGGGVFREFLSELIKTAFDPNRGFFMVTTDNKL--YPNPNVA 848
            ..|.:...::.||.     |..:|.|||.:||...:::...||..|.|....|::|  :.:..  
Mouse   731 NIDYKKPLKVIFVG-----EDAVDAGGVRKEFFLLIMRELLDPKYGMFRYYEDSRLIWFSDKT-- 788

  Fly   849 DLFEDYEKHYYFIGRILGKSIYENLLVEL--PLAEFFLTKLAGKYSDVDIHQLASLDPELYRNLL 911
              |||.:. ::.||.|.|.:||...:|:|  |||.:  .||..:...:|  .|..|.|.:.|::.
Mouse   789 --FEDSDL-FHLIGVICGLAIYNFTIVDLHFPLALY--KKLLKRKPSLD--DLKELMPAVGRSMQ 846

  Fly   912 YLKDY-SGDVSE-LNLDFTVASSSLGQTQIVELKPQGQSIPVTNSNRIEYLQLIADYKLNVQIRR 974
            .|.|| ..|:.| ..|:||:...:.|.|::.||...|....|...||.|::....||..|..:..
Mouse   847 QLLDYPEDDIEETFCLNFTITVENFGATEVKELVLNGADTAVNRQNRQEFVDAYVDYIFNKSVAS 911

  Fly   975 HCNAFRKGLSNVLPIEWLYMFSNKELQILISGAEIPIDLEDLKKHCEYGGEFSPEHPSIVTFWEV 1039
            ..:||..|...|...:.|.:|...|||.::.| ....|.::|:|:.||.||:..:||:|..||||
Mouse   912 LFDAFHAGFHKVCGGKVLLLFQPNELQAMVIG-NTNYDWKELEKNTEYKGEYWADHPTIKIFWEV 975

  Fly  1040 LEGFDDMQRRQLLKFVTSCSRPPLLGFKDLDPPFFIQNTGDMER-LPTASTCTNLLKLPPFKTVE 1103
            .......:::|.|.|:|...|.|:||.|.|  ...||:||..|. ||.:.||.|||.||.:...|
Mouse   976 FHELPLEKKKQFLLFLTGSDRIPILGMKSL--KLVIQSTGGGESYLPVSHTCFNLLDLPKYTEKE 1038

  Fly  1104 QMREKLLYAIQSGAGFEL 1121
            .:|.||:.||....||.|
Mouse  1039 TLRCKLIQAIDHNEGFSL 1056

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3356NP_611896.1 HECTc 766..1120 CDD:238033 119/360 (33%)
HECTc 788..1119 CDD:214523 111/337 (33%)
Herc4NP_084390.1 RCC1 1 1..51
RCC1 3..49 CDD:278826
RCC1 2 52..101
RCC1 52..99 CDD:278826
RCC1 3 102..154
RCC1 102..152 CDD:278826
RCC1 4 156..207
RCC1 157..205 CDD:278826
RCC1 5 208..259
RCC1 208..257 CDD:278826
RCC1 260..308 CDD:278826
RCC1 6 261..311
RCC1 7 313..366
RCC1 313..>343 CDD:278826
HECTc 709..1055 CDD:238033 119/362 (33%)
HECTc 735..1054 CDD:214523 110/335 (33%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5021
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.