powered by:
Protein Alignment CG3356 and wwtr1
DIOPT Version :9
Sequence 1: | NP_611896.1 |
Gene: | CG3356 / 37876 |
FlyBaseID: | FBgn0034989 |
Length: | 1122 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_001032785.1 |
Gene: | wwtr1 / 568008 |
ZFINID: | ZDB-GENE-051101-1 |
Length: | 391 |
Species: | Danio rerio |
Alignment Length: | 48 |
Identity: | 15/48 - (31%) |
Similarity: | 20/48 - (41%) |
Gaps: | 18/48 - (37%) |
- Green bases have known domain annotations that are detailed below.
Fly 519 SAPLTLISKGVVPKHQGVDRTIPLLATFCMLFGRLLPTLHDVEFVENK 566
|.|.|.:..|.: :|.| |:|.|:|||.|.||
Zfish 354 SMPGTNVDLGTL---EGTD---------------LMPILNDVESVLNK 383
|
Known Domains:
Indicated by green bases in alignment.
Gene | Sequence | Domain | Region |
External ID | Identity |
CG3356 | NP_611896.1 |
HECTc |
766..1120 |
CDD:238033 |
|
HECTc |
788..1119 |
CDD:214523 |
|
wwtr1 | NP_001032785.1 |
WW |
115..146 |
CDD:197736 |
|
Blue background indicates that the domain is not in
the aligned region.
|
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
1 |
0.900 |
- |
- |
|
E1_COG5021 |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
0 | 0.000 |
Not matched by this tool. |
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
ZFIN |
0 | 0.000 |
Not matched by this tool. |
|
1 | 0.900 |
|
Return to query results.
Submit another query.