Sequence 1: | NP_611896.1 | Gene: | CG3356 / 37876 | FlyBaseID: | FBgn0034989 | Length: | 1122 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001314782.1 | Gene: | magi2a / 564112 | ZFINID: | ZDB-GENE-050810-4 | Length: | 1503 | Species: | Danio rerio |
Alignment Length: | 267 | Identity: | 53/267 - (19%) |
---|---|---|---|
Similarity: | 91/267 - (34%) | Gaps: | 81/267 - (30%) |
- Green bases have known domain annotations that are detailed below.
Fly 564 ENKLLLQVHS----TINHVRLMPFSIAEIIQMSKTLKDISMGLVELAFPETRSNLANYRKVLGH- 623
Fly 624 --TEADDKKLRHQKQIWANLLNVVVFVLNQIHTRDLRLGFCPEDHWTVTRLDLPLDRPTDLPLTH 686
Fly 687 SSRL----------RGIRPFQPIRDFTREDF-----------------ENGPPMSTKQIRSI--- 721
Fly 722 TILREIPF-----VVPFNKRVSILQSLVAASKMR-VQGNMQAFLQGPSVLITVRRSHLYEDAYDK 780
Fly 781 LRPDNEP 787 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG3356 | NP_611896.1 | HECTc | 766..1120 | CDD:238033 | 7/22 (32%) |
HECTc | 788..1119 | CDD:214523 | 53/267 (20%) | ||
magi2a | NP_001314782.1 | PDZ_signaling | 25..100 | CDD:238492 | |
NK | 122..286 | CDD:302627 | |||
WW | 307..337 | CDD:238122 | |||
WW | 352..381 | CDD:278809 | |||
PDZ | 431..511 | CDD:214570 | |||
PDZ | 595..676 | CDD:214570 | 11/59 (19%) | ||
PDZ | 762..856 | CDD:214570 | 20/102 (20%) | ||
PDZ_signaling | 920..1007 | CDD:238492 | |||
PDZ_signaling | 1182..1262 | CDD:238492 | |||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_COG5021 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
ZFIN | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.900 |