DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3356 and magi2a

DIOPT Version :9

Sequence 1:NP_611896.1 Gene:CG3356 / 37876 FlyBaseID:FBgn0034989 Length:1122 Species:Drosophila melanogaster
Sequence 2:NP_001314782.1 Gene:magi2a / 564112 ZFINID:ZDB-GENE-050810-4 Length:1503 Species:Danio rerio


Alignment Length:267 Identity:53/267 - (19%)
Similarity:91/267 - (34%) Gaps:81/267 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly   564 ENKLLLQVHS----TINHVRLMPFSIAEIIQMSKTLKDISMGLVELAFPETRSNLANYRKVLGH- 623
            |..|:::::.    |::|.           |:.:.||:..:|        |.:.|...|...|| 
Zfish   635 EGDLIVEINQQPALTLSHT-----------QVVELLKECPIG--------TEATLVIQRGGTGHF 680

  Fly   624 --TEADDKKLRHQKQIWANLLNVVVFVLNQIHTRDLRLGFCPEDHWTVTRLDLPLDRPTDLPLTH 686
              .:...:.|.|...:.:...::.|..|.  |:       .|..||. :..:..|.:|....|..
Zfish   681 SPWKTTKQVLEHWDPLSSPTTSLSVHALP--HS-------APYLHWP-SGPEFDLAKPDPYDLYE 735

  Fly   687 SSRL----------RGIRPFQPIRDFTREDF-----------------ENGPPMSTKQIRSI--- 721
            .||.          |...|..|..:|...:.                 |.|.|:|.|....|   
Zfish   736 KSRAIYENRQPGLPRASLPADPSAEFQEVEVHLRRQKSGFGFRILGGEEPGQPVSPKAQEKILIG 800

  Fly   722 TILREIPF-----VVPFNKRVSILQSLVAASKMR-VQGNMQAFLQGPSVLITVRRSHLYEDAYDK 780
            .|:.:.|.     :.|.::.:|:...:||....| |...|....:...|.:||||         :
Zfish   801 AIIEKSPADKDGRLRPGDELISVDGIVVAGKPHRYVIDLMHGAARTGQVKLTVRR---------R 856

  Fly   781 LRPDNEP 787
            ::|..||
Zfish   857 VQPTGEP 863

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3356NP_611896.1 HECTc 766..1120 CDD:238033 7/22 (32%)
HECTc 788..1119 CDD:214523 53/267 (20%)
magi2aNP_001314782.1 PDZ_signaling 25..100 CDD:238492
NK 122..286 CDD:302627
WW 307..337 CDD:238122
WW 352..381 CDD:278809
PDZ 431..511 CDD:214570
PDZ 595..676 CDD:214570 11/59 (19%)
PDZ 762..856 CDD:214570 20/102 (20%)
PDZ_signaling 920..1007 CDD:238492
PDZ_signaling 1182..1262 CDD:238492
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5021
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.