DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3356 and nedd4l

DIOPT Version :9

Sequence 1:NP_611896.1 Gene:CG3356 / 37876 FlyBaseID:FBgn0034989 Length:1122 Species:Drosophila melanogaster
Sequence 2:XP_021324687.1 Gene:nedd4l / 559634 ZFINID:ZDB-GENE-051118-2 Length:1279 Species:Danio rerio


Alignment Length:361 Identity:125/361 - (34%)
Similarity:205/361 - (56%) Gaps:18/361 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly   768 VRRSHLYEDAYDKLRPDNEPD-LRFKFRIQFVSSLGLDEAGIDGGGVFREFLSELIKTAFDPNRG 831
            :.|::::|::|.::.....|| |:.:..|:|.|     |.|:|.|||.||:...|.|..|:|..|
Zfish   926 LHRNNIFEESYRRIMSLKRPDSLKARLWIEFES-----EKGLDYGGVAREWFFLLSKEMFNPYYG 985

  Fly   832 FFMVT-TDN-KLYPNPNVADLFEDYEKHYYFIGRILGKSIYENLLVELPLAEFFLTKLAGKYSDV 894
            .|..: ||| .|..|||.....||:..::.||||:.|.::|...|::......|...:.||  .:
Zfish   986 LFEYSATDNYTLQINPNSGLCNEDHLSYFKFIGRVAGMAVYHGKLLDGFFIRPFYKMMLGK--QI 1048

  Fly   895 DIHQLASLDPELYRNLLYLKDYSGDVSELNLDFTVASSSLGQTQIVELKPQGQSIPVTNSNRIEY 959
            .::.:.|:|.|.|.:|.::.:  .|.:||:|.|.:...:.|||..|:|||.|..:.|||.|:.||
Zfish  1049 TLNDMESVDSEYYNSLKWILE--NDPTELDLRFCIDEDNFGQTYQVDLKPSGSDMVVTNDNKKEY 1111

  Fly   960 LQLIADYKLNVQIRRHCNAFRKGLSNVLPIEWLYMFSNKELQILISGAEIPIDLEDLKKHCEYGG 1024
            :.|:..::...::::..|||.:|.:.::||:.:.:|...||::|:.|.. .:|:.|.::|..|..
Zfish  1112 IDLVIQWRFVNRVQKQMNAFLEGFTELIPIDLIKIFDENELELLMCGLG-DVDVNDWRQHTVYKN 1175

  Fly  1025 EFSPEHPSIVTFWEVLEGFDDMQRRQLLKFVTSCSRPPLLGFKDL----DPPFF-IQNTGDMERL 1084
            .:.|.||.|..||:.:...|..:|.:||:|||..||.|:.||.:|    .|..| |:..|..::|
Zfish  1176 GYCPNHPVIQWFWKAVLLMDAEKRIRLLQFVTGTSRVPMNGFAELYGSNGPQLFTIEQWGTPDKL 1240

  Fly  1085 PTASTCTNLLKLPPFKTVEQMREKLLYAIQSGAGFE 1120
            |.|.||.|.|.||.::|.|.:|||||.|:::..|||
Zfish  1241 PRAHTCFNRLDLPMYETFEDLREKLLMAVENAQGFE 1276

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3356NP_611896.1 HECTc 766..1120 CDD:238033 123/359 (34%)
HECTc 788..1119 CDD:214523 118/338 (35%)
nedd4lXP_021324687.1 C2 <374..430 CDD:326325
WW 473..499 CDD:306827
WW 669..698 CDD:306827
WW 798..829 CDD:197736
WW 856..885 CDD:238122
HECTc 946..1275 CDD:214523 118/338 (35%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.