DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3356 and herc4

DIOPT Version :9

Sequence 1:NP_611896.1 Gene:CG3356 / 37876 FlyBaseID:FBgn0034989 Length:1122 Species:Drosophila melanogaster
Sequence 2:XP_005173092.1 Gene:herc4 / 557513 ZFINID:ZDB-GENE-070801-1 Length:1052 Species:Danio rerio


Alignment Length:717 Identity:195/717 - (27%)
Similarity:302/717 - (42%) Gaps:152/717 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly   492 LYTLA--FTPKFIRAVWFKLAAEST---QLGFSAPLTL---ISKGVVPKH-------QGVDRTIP 541
            :|||:  ...|::.....::.||.|   .|.||:...|   ......|.|       .|||    
Zfish   400 IYTLSTELIQKWLNHGLGRIPAEITDEIDLVFSSASCLNGSFLSSSNPDHYSTSSKCSGVD---- 460

  Fly   542 LLATFCMLFGRLLPTLHD------VEFVENKLLLQVHST---INHVRL----------------- 580
             :.|..:||.:|:.|.|.      ...:|..||.::.|:   |..:||                 
Zfish   461 -INTARLLFHKLIQTDHPQISQIIAASLEKNLLPKLSSSPPDIEALRLYLTLPECPLLCNPNNFT 524

  Fly   581 ---MPFSIAEIIQMSKTLKD----------------ISMGLVELAFPETRSNLANYRKVLGHTEA 626
               :||:.|.:     :|||                :...||||           |::|:.:.  
Zfish   525 TLTIPFAKAIV-----SLKDAPIKVLGNWWSRFEPVVFQRLVEL-----------YKEVVVYL-- 571

  Fly   627 DDKKLRHQK--------QIWANLLNVVVFVLNQIHTRDLRLG-FCPEDHWTVTRLDLPLDRPTDL 682
                ||.||        :|:...|:..:.:|..:|:.:.|.| ....|.:.:..||..:|...|.
Zfish   572 ----LRMQKLGIPLSEQRIFTCFLDTSLKLLEILHSVNERAGQIIQYDKFYIHELDELIDIRNDY 632

  Fly   683 PLTHSSRLRGIRPFQPIRDFTREDFENGPPMSTKQIRSITILREIPFVVPFNKRVSILQS----- 742
            ......::     |..:.|                  |...|.:.|||.....:.::||:     
Zfish   633 ATWFQQQM-----FSVVMD------------------SQVTLCKYPFVFDAQAKTALLQTDAVIQ 674

  Fly   743 -LVAASKMRVQGNMQAFLQG-------PSVLITVRRSHLYEDAYDKLRPDNEPDLRFKFRIQFVS 799
             .:|..:.:.|.....||.|       |.:::.|||.::..|:.:.||.....|.:...::.||.
Zfish   675 MQMAVDQAQRQNFTSLFLSGGGVESVNPCLILIVRRENVVGDSMEVLRKSKNVDYKKPLKVIFVG 739

  Fly   800 SLGLDEAGIDGGGVFREFLSELIKTAFDPNRGFFMVTTDNKLYPNPNVADLFEDYEKHYYFIGRI 864
                 |..:|.|||.:||...::|....|..|.|....:::|.  ......|||.:. ::.||.:
Zfish   740 -----EEAVDAGGVRKEFFLLIMKELLHPKYGMFRFHEESRLI--WFACKTFEDIDL-FHLIGVV 796

  Fly   865 LGKSIYENLLVEL--PLAEFFLTKLAGKYSDVDIHQLASLDPELYRNLLYLKDYSGDVSE--LNL 925
            .|.:||...:|||  |||.:  .||..|...::  .|..|.|::.|:|..|.||:.|..|  ..|
Zfish   797 CGLAIYNLTIVELNFPLALY--KKLLKKTPTLE--DLKELMPDVGRSLQQLLDYTEDDLEETFCL 857

  Fly   926 DFTVASSSLGQTQIVELKPQGQSIPVTNSNRIEYLQLIADYKLNVQIRRHCNAFRKGLSNVLPIE 990
            :||:...:.|.|::|||.|.|..|.|..|||.|::....||..|..:....:||..|...|...:
Zfish   858 NFTITEDNFGATEVVELIPNGTDISVNKSNRQEFVNAYVDYIFNKSVAPQFSAFYAGFHKVCGGK 922

  Fly   991 WLYMFSNKELQILISGAEIPIDLEDLKKHCEYGGEFSPEHPSIVTFWEVLEGFDDMQRRQLLKFV 1055
            .|.:|...|||.::.| ....|.::|:|..||.||:..:||:|..||||.......:::|.|.|:
Zfish   923 VLELFQPSELQAMVIG-NTNYDWKELEKSTEYKGEYWADHPTIKIFWEVFHELPLEKKKQFLLFL 986

  Fly  1056 TSCSRPPLLGFKDLDPPFFIQNT-GDMERLPTASTCTNLLKLPPFKTVEQMREKLLYAIQSGAGF 1119
            |...|.|:||.|.|  ...||.| |..:..|.|.||.|||.||.:.:...|:||||:||:...||
Zfish   987 TGSDRIPILGMKSL--ALVIQPTAGGEQYFPVAHTCFNLLDLPKYTSKNTMQEKLLHAIEHNQGF 1049

  Fly  1120 EL 1121
            .|
Zfish  1050 NL 1051

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3356NP_611896.1 HECTc 766..1120 CDD:238033 122/358 (34%)
HECTc 788..1119 CDD:214523 115/335 (34%)
herc4XP_005173092.1 RCC1 3..49 CDD:278826
RCC1 52..99 CDD:278826
RCC1 102..152 CDD:278826
RCC1 156..205 CDD:278826
RCC1 208..257 CDD:278826
RCC1 260..308 CDD:278826
RCC1 313..377 CDD:278826
HECTc 704..1049 CDD:238033 121/359 (34%)
HECTc 730..1049 CDD:214523 114/333 (34%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5021
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.