DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3356 and HERC6

DIOPT Version :9

Sequence 1:NP_611896.1 Gene:CG3356 / 37876 FlyBaseID:FBgn0034989 Length:1122 Species:Drosophila melanogaster
Sequence 2:XP_005263140.1 Gene:HERC6 / 55008 HGNCID:26072 Length:1034 Species:Homo sapiens


Alignment Length:682 Identity:163/682 - (23%)
Similarity:276/682 - (40%) Gaps:128/682 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly   503 RAVWFKLAAESTQLGFSAPLTLISKGVVPKHQGVDRT----------------------IPLLAT 545
            |:...::|....::.||:|..|.:..:  |.:|...|                      |..:.|
Human   408 RSTEHEMAKSEIRMIFSSPACLTASFL--KKRGTGETTSIDVDLEMARDTFKKLTKKEWISSMIT 470

  Fly   546 FCM---LFGRLLP--TLHDVEFVENKLLLQ----VHSTINHVRL-MPFSIAEIIQMSKT------ 594
            .|:   |. |.||  :.|. |.:...|||.    :|.:.|...| :||:.| :.:|||.      
Human   471 TCLEDDLL-RALPCHSPHQ-EALSVFLLLPECPVMHDSKNWKNLVVPFAKA-VCEMSKQSLQVLK 532

  Fly   595 -----LKDISMG-LVELAFPETRSNLANYRKVLGHTEADDKKLRHQKQIWANLLNVVVFVLNQIH 653
                 |::.|:. |:::......|.|.:..|    ||.|...::       .||.::. .|::::
Human   533 KCWAFLQESSLNPLIQMLKAAIISQLLHQTK----TEQDHCNVK-------ALLGMMK-ELHKVN 585

  Fly   654 TRDLRLGFCPEDHWTVTRLDLPLDRPTDLPLTHSSRLRGIRPFQPIRDFTREDFENGPPMSTKQI 718
            ..:.||   ||:.:.:..|...|:...|         ||.:.|   ||......|...|:     
Human   586 KANCRL---PENTFNINELSNLLNFYID---------RGRQLF---RDNHLIPAETPSPV----- 630

  Fly   719 RSITILREIPFVVPFNKRVSILQSLVAASKMRVQ-GNMQAFL--------------QGPSVLITV 768
                |..:.||:.....::.:||   |.|.:::| ...:|::              ..|..::.|
Human   631 ----IFSDFPFIFNSLSKIKLLQ---ADSHIKMQMSEKKAYMLMHETILQKKDEFPPSPRFILRV 688

  Fly   769 RRSHLYEDAYDKLRPDNEPDLRFKFRIQFVSSLGLDEAGIDGGGVFREFLSELIKTAFDPNRGFF 833
            |||.|.:||..:|......|......::|:     :|...:.|||..||...:.:....|..|.|
Human   689 RRSRLVKDALRQLSQAEATDFCKVLVVEFI-----NEICPESGGVSSEFFHCMFEEMTKPEYGMF 748

  Fly   834 MVTTDNKLYPNPNVADLF----EDYEKHYYFIGRILGKSIYENLLVELPLAEFFLTKLAGKYSDV 894
            |       ||.......|    :..:|.|:..|.:.|.|::...:..||.......||..:...:
Human   749 M-------YPEMGSCMWFPAKPKPEKKRYFLFGMLCGLSLFNLNVANLPFPLALYKKLLDQKPSL 806

  Fly   895 DIHQLASLDPELYRNLL-YLKDYSGDVSE-LNLDFTVASSSLGQTQIVELKPQGQSIPVTNSNRI 957
            :  .|..|.|.|.::|. .|.|.:.|:.: |.:.|::.    .....|:|.|.|.||||..:|:.
Human   807 E--DLKELSPRLGKSLQEVLDDAADDIGDALCIRFSIH----WDQNDVDLIPNGISIPVDQTNKR 865

  Fly   958 EYLQLIADYKLNVQIRRHCNAFRKGLSNVLPIEWLYMFSNKELQILISGAEIPIDLEDLKKHCEY 1022
            :|:....||..||.::.....|::|...|...|.|..|..:||...|.| ....|.:..:::.:|
Human   866 DYVSKYIDYIFNVSVKAVYEEFQRGFYRVCEKEILRHFYPEELMTAIIG-NTDYDWKQFEQNSKY 929

  Fly  1023 GGEFSPEHPSIVTFWEVLEGFDDMQRRQLLKFVTSCSRPPLLGFKDLDPPFFIQNTGDMERLPTA 1087
            ...:...||:|..||:........::::.|.|:|...|....|.:.::..|....|......||:
Human   930 EQGYQKSHPTIQLFWKAFHKLTLDEKKKFLFFLTGRDRLHARGIQKMEIVFRCPETFSERDHPTS 994

  Fly  1088 STCTNLLKLPPFKTVEQMREKLLYAIQSGAGF 1119
            .||.|:|.||.:.|:|:|.|.|..||.:..||
Human   995 ITCHNILSLPKYSTMERMEEALQVAINNNRGF 1026

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3356NP_611896.1 HECTc 766..1120 CDD:238033 97/360 (27%)
HECTc 788..1119 CDD:214523 87/336 (26%)
HERC6XP_005263140.1 RCC1_2 27..54 CDD:290274
RCC1_2 89..118 CDD:290274
RCC1 105..155 CDD:278826
RCC1 158..208 CDD:278826
RCC1 215..263 CDD:278826
RCC1_2 250..279 CDD:290274
RCC1 266..313 CDD:278826
HECTc 684..1026 CDD:238033 95/360 (26%)
HECTc 711..1026 CDD:214523 86/333 (26%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5021
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.