DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3356 and yki

DIOPT Version :9

Sequence 1:NP_611896.1 Gene:CG3356 / 37876 FlyBaseID:FBgn0034989 Length:1122 Species:Drosophila melanogaster
Sequence 2:NP_001350857.1 Gene:yki / 37851 FlyBaseID:FBgn0034970 Length:418 Species:Drosophila melanogaster


Alignment Length:277 Identity:54/277 - (19%)
Similarity:91/277 - (32%) Gaps:84/277 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly   164 MLETFT----TVSSVQQYMKDEAVLFQYMERVFGFLIARNYFVRLRRLLDDKCPPLDGETLHAPS 224
            ||.|.:    |.|.:::.:.||.:|..        :.:.|..||:.:..||.             
  Fly    24 MLTTMSASSNTNSLIEKEIDDEDMLSP--------IKSNNLVVRVNQDTDDN------------- 67

  Fly   225 PLAEALLQLLLRPLEVAKRASAGGQMSSMSMAVCRNFTRDILATPHTDPLRYFVLPCFALNVDFP 289
              .:||...:|.|.: |||                         |...|||...||    |..|.
  Fly    68 --LQALFDSVLNPGD-AKR-------------------------PLQLPLRMRKLP----NSFFT 100

  Fly   290 FDLLMRSLYDALESAGPAESDSTSSRRSFLFYGVETGHKTTRMDSIFSSFLLNSLMVLDRRQLAT 354
            ......|..::.:|...|.|.|:          :..|:|.:.:......   :.:..:.:.|:..
  Fly   101 PPAPSHSRANSADSTYDAGSQSS----------INIGNKASIVQQPDGQ---SPIAAIPQLQIQP 152

  Fly   355 LHQSPLLVIYVRLIAEMMPNILQLPKSTLRGHANAPHRHRDGDDDSEES--------EDEDEEL- 410
            ..|...|.|: ...|...|..|| ....:|..::|...:....:.|.:.        |:..:|. 
  Fly   153 SPQHSRLAIH-HSRARSSPASLQ-QNYNVRARSDAAAANNPNANPSSQQQPAGPTFPENSAQEFP 215

  Fly   411 ---PAARTLDYDMEQTC 424
               ||:..:|.|...||
  Fly   216 SGAPASSAIDLDAMNTC 232

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3356NP_611896.1 HECTc 766..1120 CDD:238033
HECTc 788..1119 CDD:214523
ykiNP_001350857.1 HUL4 <261..>404 CDD:227354
WW 266..295 CDD:395320
WW 335..364 CDD:395320
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5021
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.