DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3356 and Smurf

DIOPT Version :9

Sequence 1:NP_611896.1 Gene:CG3356 / 37876 FlyBaseID:FBgn0034989 Length:1122 Species:Drosophila melanogaster
Sequence 2:NP_001261061.1 Gene:Smurf / 36999 FlyBaseID:FBgn0029006 Length:1061 Species:Drosophila melanogaster


Alignment Length:373 Identity:114/373 - (30%)
Similarity:194/373 - (52%) Gaps:37/373 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly   766 ITVRRSHLYEDAYDKLRPDNEPDLRFKFRIQFVSSLGLDEAGIDGGGVFREFLSELIKTAFDPNR 830
            :.|.|:.::|::|..:......|:|.:..::|..     |.|:|.|||.||:|..|.:...:|..
  Fly   704 LEVSRNEIFEESYRLIMKMRAKDMRKRLMVKFKG-----EEGLDYGGVAREWLHLLSREMLNPQY 763

  Fly   831 GFFMVTTDN--KLYPNPNVADLFEDYEKHYYFIGRILGKSIYENLLVELPLAEFFLTKLAGKYSD 893
            |.|..:.|:  .|..||: :.:..|:..:::|:||.||.:::....::......|..:|..|  .
  Fly   764 GLFQYSRDDHYTLQINPD-SGVNPDHLSYFHFVGRTLGIAVFHGHCLDGGFTTPFYKQLLNK--P 825

  Fly   894 VDIHQLASLDPELYRNLLYL--KDYSGDVSELNLDFTVASSSLGQTQIVELKPQGQSIPVTNSNR 956
            :.:..:..:||:|:|:|.::  .:.||.:..   .|:|.::|.|...:.||||.|.|||||..|:
  Fly   826 ITLGDIEGVDPDLHRSLTWMLESNISGIIES---TFSVENNSFGALVVHELKPGGASIPVTEENK 887

  Fly   957 IEYLQLIADYKLNVQIRRHCNAFRKGLSNVLPIEWLYMFSNKELQILISGAEIPIDLEDLK---- 1017
            .||::|..:|:....|.:...|.:||...::|...|..|..:||:::|.|.. .||:.|.:    
  Fly   888 REYVKLYVNYRFMRGIEQQFLALQKGFCELIPSHLLRPFDERELELVIGGIS-SIDVNDWRNNTR 951

  Fly  1018 -KHCEYGGEFSPEHPSIVTFWEVLEGFDDMQRRQLLKFVTSCSRPPLLGFKDLD-------PPFF 1074
             |||      :.|...::.||:|:|.:....|.:||:|||..||.||.||:.|.       |..|
  Fly   952 LKHC------TNETTQVLWFWQVVESYSSEMRARLLQFVTGSSRVPLQGFRALQGSTGAVGPRLF 1010

  Fly  1075 -IQNTGDM--ERLPTASTCTNLLKLPPFKTVEQMREKLLYAIQSGAGF 1119
             |..|.|:  :.||.|.||.|.:.|||::|.:.:.:||..|::...||
  Fly  1011 TIHLTADVPTQNLPKAHTCFNRIDLPPYETYQLLCDKLTQAVEETCGF 1058

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3356NP_611896.1 HECTc 766..1120 CDD:238033 114/373 (31%)
HECTc 788..1119 CDD:214523 108/349 (31%)
SmurfNP_001261061.1 C2_Smurf-like 14..135 CDD:176028
WW 169..198 CDD:278809
WW 514..546 CDD:197736
WW 562..594 CDD:197736
HECTc 702..1058 CDD:238033 112/371 (30%)
HECTc 726..1058 CDD:214523 108/349 (31%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45446956
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5021
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.740

Return to query results.
Submit another query.