DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3356 and CG4238

DIOPT Version :9

Sequence 1:NP_611896.1 Gene:CG3356 / 37876 FlyBaseID:FBgn0034989 Length:1122 Species:Drosophila melanogaster
Sequence 2:NP_001259896.1 Gene:CG4238 / 33377 FlyBaseID:FBgn0031384 Length:977 Species:Drosophila melanogaster


Alignment Length:702 Identity:162/702 - (23%)
Similarity:268/702 - (38%) Gaps:180/702 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly   476 HNLMIYNKHAVFEYKLLYTLAFT----------------PKFIRAVWFKLAAESTQLG------- 517
            :.:.||:.|.|...||.:.:.|.                |..:|||   ::....||.       
  Fly   395 YQVAIYDLHGVPVEKLQHAIVFAYDKVNSRVSVTALFPEPTCLRAV---ISYRDQQLPNGDFDII 456

  Fly   518 --FSAPLTLISKGVVPKHQGVDRTIPLLATFCMLFGRLLPTLHDVEFVENKLLLQVHSTINHVRL 580
              .|:..||:.|.:..:...:.....||:.|.:...:....|..|...:|.|:.||         
  Fly   457 VLSSSDTTLVHKNIASRKHNICYEAKLLSIFGVSKNKPRKVLCYVGPKQNSLIFQV--------- 512

  Fly   581 MPFSIAEIIQMSKTLKDISMGLVELAFPETRSNLANYRKVLGHTEADDKKLRHQKQIWANLLNVV 645
                         |:|::.:..:.       ..:|.:|.      ....|.....|: .:.|:..
  Fly   513 -------------TIKEMILKFIP-------KRIATFRL------CPSTKFHFLPQL-VSQLHGP 550

  Fly   646 VFVLN-------QIHTRDLRLGFCPEDHWTVTRLDLPLDRPTDLPLTHSSRLRGIRPFQPIRDFT 703
            ||:::       ::.::|..:......|:.:                  ..:.|...|:..:||.
  Fly   551 VFIIDDGAQPKIELASKDRNIIAATFTHFLL------------------KNIGGSETFKDKQDFF 597

  Fly   704 REDFENGPPMSTKQIRSITILREIPFVVPFNKRVSILQSLVAASK-MRVQ---GNMQAFLQGPSV 764
            ..:..........:..::.:.||           .||:|.:.|.| ..|.   ||.:...||   
  Fly   598 YHEVRKFHASYYHEKMALKVQRE-----------KILESSMKAVKGFSVSDWCGNFEVTFQG--- 648

  Fly   765 LITVRRSHLYEDAYDKLRPDNEPDLRFKFRIQFVSSLGLDEAGIDGGGVFREFLSELIKTAFDPN 829
                                                    |.|||.||:.||:...:....||..
  Fly   649 ----------------------------------------EQGIDWGGLRREWFELVCSALFDAR 673

  Fly   830 RGFFMVTTDNK---LYPNP-NVADLFEDYEKHYYFIGRILGKSIYENL-------LVELPLAEFF 883
            .|.|....|..   ::||| ..|.|   ..||:.|.|:::||.::|:.       ||....:..|
  Fly   674 GGLFCTFHDKHQALVHPNPTRPAHL---KLKHFEFAGKMVGKCLFESALGGTYRQLVRARFSRSF 735

  Fly   884 LTKLAG-----KYSDVDIHQLASLDPELY-RNLLYLKDYSGDVSE-LNLDFT--VASSSLGQ-TQ 938
            |.:|.|     ||.:.|       ||:|| ..:.|:.|...|.:: |.|.|.  :..||.|| ::
  Fly   736 LAQLIGLRVHYKYFEQD-------DPDLYLSKIKYILDTDLDATDTLELYFVEEMYDSSSGQLSK 793

  Fly   939 IVELKPQGQSIPVTNSNRIEYLQLIADYKLNVQIRRHCNAFRKGLSNVLPIEWLYMFSNKELQIL 1003
            .:||.|.|....|||:.:.:||..:|..:|...::...::|.|||::::|...|.:|...||::|
  Fly   794 TIELIPNGAKTRVTNATKNQYLDALAQQRLCNNVKDEVDSFLKGLNSIIPDNLLSIFDENELELL 858

  Fly  1004 ISGAEIPIDLEDLKKHCEYGGEFSPEHPSIVTFWEVLEGFDDMQRRQLLKFVTSCSRPPLLGFKD 1068
            :.|.. ...:.|.|.|....|..:.....:..||..:..|...:..:||:|.|.||:.|..||::
  Fly   859 MCGTG-EYSISDFKAHHIANGNSAEFRRVLAWFWAGVSNFSQTEMARLLQFTTGCSQLPPGGFQE 922

  Fly  1069 LDPPFFIQNTGDMERLPTASTCTNLLKLPPFKTVEQMREKLLYAIQSGA-GF 1119
            |:|.|.|........||||.||.|.|.||.:::.||..:.||.||..|: ||
  Fly   923 LNPQFQITAAPTFGNLPTAHTCFNQLCLPDYESYEQFEKSLLLAISEGSEGF 974

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3356NP_611896.1 HECTc 766..1120 CDD:238033 109/376 (29%)
HECTc 788..1119 CDD:214523 107/352 (30%)
CG4238NP_001259896.1 IG_FLMN 238..336 CDD:214720
Filamin 238..336 CDD:279024
HECTc 615..975 CDD:238033 121/425 (28%)
HECTc 642..974 CDD:214523 109/385 (28%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45446946
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5021
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.740

Return to query results.
Submit another query.