DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3356 and Hecw2

DIOPT Version :9

Sequence 1:NP_611896.1 Gene:CG3356 / 37876 FlyBaseID:FBgn0034989 Length:1122 Species:Drosophila melanogaster
Sequence 2:NP_001101688.1 Gene:Hecw2 / 316395 RGDID:1593244 Length:1578 Species:Rattus norvegicus


Alignment Length:461 Identity:134/461 - (29%)
Similarity:216/461 - (46%) Gaps:71/461 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly   675 PLDRPTDLPLTHSSRLRGIRPFQPIRDFTREDFENGPPMSTKQIRSITILREIPFVVPFNKRVSI 739
            |:..|.:.|.|..:..|...|:       :.|||       .::|:.                  
  Rat  1174 PVSSPQNSPGTQRANARAPAPY-------KRDFE-------AKLRNF------------------ 1206

  Fly   740 LQSLVAASKMRVQGNMQAFLQGPSVL-ITVRRSHLYEDAYDKLRPDNEPDL-RFKFRIQFVSSLG 802
                  ..|:..:|    :.|||..| :.:||.||.|||::::...:..|| |.|..:.||.   
  Rat  1207 ------YRKLETKG----YGQGPGKLKLIIRRDHLLEDAFNQIMGYSRKDLQRNKLYVTFVG--- 1258

  Fly   803 LDEAGIDGGGVFREFLSELIKTAFDPNRGFFMVTTDNKLYPNPNVADLFED-YEKHYYFIGRILG 866
              |.|:|..|..|||...:.:..|:|..|.|..:.::......:....|.| :.:.:.|.|||||
  Rat  1259 --EEGLDYSGPSREFFFLVSRELFNPYYGLFEYSANDTYTVQISPMSAFVDNHHEWFRFSGRILG 1321

  Fly   867 KSIYENLLVEL----PLAEFFLTKLAGKYSDVDIHQLASLDPELYRNLLYLKDYSGDVSE-LNLD 926
            .::....|::.    |..:..|..|.      |:..|..||.|.:::|.::||  .|:.: |:|.
  Rat  1322 LALIHQYLLDAFFTRPFYKALLRILC------DLSDLEYLDEEFHQSLQWMKD--NDIHDILDLT 1378

  Fly   927 FTVASSSLGQTQIVELKPQGQSIPVTNSNRIEYLQLIADYKLNVQIRRHCNAFRKGLSNVLPIEW 991
            |||.....||....||||.|.:||||..|:.||::.:..:::...:.:...:..:|...|:....
  Rat  1379 FTVNEEVFGQITERELKPGGANIPVTEKNKKEYIERMVKWRIERGVVQQTESLVRGFYEVVDARL 1443

  Fly   992 LYMFSNKELQILISG-AEIPIDLEDLKKHCEYGGEFSPEHPSIVTFWEVLEGFDDMQRRQLLKFV 1055
            :.:|..:||:::|:| ||  |||.|.:.:.||.|.:...|..|..||..:|.|::.||.:||:||
  Rat  1444 VSVFDARELELVIAGTAE--IDLNDWRNNTEYRGGYHDNHIVIRWFWAAVERFNNEQRLRLLQFV 1506

  Fly  1056 TSCSRPPLLGFKDL---DPP--FFIQNTGDMERLPTASTCTNLLKLPPFKTVEQMREKLLYAIQS 1115
            |..|..|..||..|   :.|  |.::..|.:..||.|.||.|.|.|||:.:...:.||||.|::.
  Rat  1507 TGTSSIPYEGFASLRGSNGPRRFCVEKWGKITALPRAHTCFNRLDLPPYPSFSMLYEKLLTAVEE 1571

  Fly  1116 GAGFEL 1121
            .:.|.|
  Rat  1572 TSTFGL 1577

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3356NP_611896.1 HECTc 766..1120 CDD:238033 116/366 (32%)
HECTc 788..1119 CDD:214523 109/343 (32%)
Hecw2NP_001101688.1 HECW_N 45..162 CDD:406866
C2_NEDL1-like 185..321 CDD:176073
MDN1 <396..741 CDD:227596
NESP55 <464..632 CDD:115071
WW 815..844 CDD:395320
HECW1_helix 921..987 CDD:408233
WW 993..1024 CDD:197736
HECTc 1222..1576 CDD:238033 117/368 (32%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5021
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.