DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3356 and Smurf2

DIOPT Version :9

Sequence 1:NP_611896.1 Gene:CG3356 / 37876 FlyBaseID:FBgn0034989 Length:1122 Species:Drosophila melanogaster
Sequence 2:NP_001100531.1 Gene:Smurf2 / 303614 RGDID:1310067 Length:748 Species:Rattus norvegicus


Alignment Length:412 Identity:138/412 - (33%)
Similarity:210/412 - (50%) Gaps:54/412 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly   731 VPFNKRVSILQSLVAASKMRVQGNMQAFLQGPSVLITVRRSHLYEDAYD---KLRP-DNEPDLRF 791
            ||..||     .||...|:..|...|...|.....|.|.|..::|::|.   |:|| |....|..
  Rat   365 VPRYKR-----DLVQKLKILRQELSQQQPQAGHCRIEVSREEIFEESYRQVMKMRPKDLWKRLMI 424

  Fly   792 KFRIQFVSSLGLDEAGIDGGGVFREFLSELIKTAFDPNRGFFMVTTDN--KLYPNPNVADLFEDY 854
            |||         .|.|:|.|||.||:|..|.....:|..|.|..:.|:  .|..||:.| :..::
  Rat   425 KFR---------GEEGLDYGGVAREWLYLLSHEMLNPYYGLFQYSRDDIYTLQINPDSA-VNPEH 479

  Fly   855 EKHYYFIGRILGKSIYENLLVE----LPLAEFFLTKLAGKYSDVDIHQLASLDPELYRNLLYL-- 913
            ..:::|:|||:|.:::....::    ||    |..:|.||...:|..:|  :||:|:.:|:::  
  Rat   480 LSYFHFVGRIMGMAVFHGHYIDGGFTLP----FYKQLLGKSITLDDMEL--VDPDLHNSLVWILE 538

  Fly   914 KDYSGDVSELNLDFTVASSSLGQTQIVELKPQGQSIPVTNSNRIEYLQLIADYKLNVQIRRHCNA 978
            .|.:|   .|:..|.|..::.|:....||||.|:|||||..|:.||::|..:::....|.....|
  Rat   539 NDITG---VLDHTFCVEHNAYGEIIQHELKPNGKSIPVTEENKKEYVRLYVNWRFLRGIEAQFLA 600

  Fly   979 FRKGLSNVLPIEWLYMFSNKELQILISGAEIPIDLEDLK-----KHCEYGGEFSPEHPSIVTFWE 1038
            .:||.:.|:|...|..|..|||:::|.|.. .||:.|.|     |||      :|:...:..||:
  Rat   601 LQKGFNEVIPQHLLKTFDEKELELIICGLG-KIDVSDWKANTRLKHC------TPDSNVVKWFWK 658

  Fly  1039 VLEGFDDMQRRQLLKFVTSCSRPPLLGFKDLD----PPFFIQNTGD--MERLPTASTCTNLLKLP 1097
            .:|.||:.:|.:||:|||..||.||.|||.|.    |..|..:..|  ...||.|.||.|.:.:|
  Rat   659 AVELFDEERRARLLQFVTGSSRVPLQGFKALQGAAGPRLFTIHQIDACTNNLPKAHTCFNRIDIP 723

  Fly  1098 PFKTVEQMREKLLYAIQSGAGF 1119
            |:::.|::.||||.||:...||
  Rat   724 PYESYEKLYEKLLTAIEETCGF 745

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3356NP_611896.1 HECTc 766..1120 CDD:238033 128/377 (34%)
HECTc 788..1119 CDD:214523 117/349 (34%)
Smurf2NP_001100531.1 C2_Smurf-like 13..137 CDD:176028
PRP40 155..>236 CDD:227435
WW 159..188 CDD:395320
WW 252..283 CDD:197736
WW 298..330 CDD:197736
HECTc 393..745 CDD:238033 126/377 (33%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.