DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3356 and Bag3

DIOPT Version :9

Sequence 1:NP_611896.1 Gene:CG3356 / 37876 FlyBaseID:FBgn0034989 Length:1122 Species:Drosophila melanogaster
Sequence 2:NP_038891.4 Gene:Bag3 / 29810 MGIID:1352493 Length:577 Species:Mus musculus


Alignment Length:131 Identity:28/131 - (21%)
Similarity:45/131 - (34%) Gaps:31/131 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly   326 GHKTTRMDSIFSSFLLNSLMVLD-------------RRQ--------LATLHQSPLLVIYVRLIA 369
            |.||.:...:...:|...|:.||             ||.        |..|.|..:.|.....:.
Mouse   449 GKKTDKKYLMIEEYLTKELLALDSVDPEGRADVRQARRDGVRKVQTILEKLEQKAIDVPGQVQVY 513

  Fly   370 EMMPNILQL--PKSTLRGHANAPHRHRDGDDDSEESED---EDEELPAARTLDYDMEQTCRTSGE 429
            |:.|:.|:.  |...:.|...|     |.|....|::|   |.::|.|......:......::|.
Mouse   514 ELQPSNLEAEQPLQEIMGAVVA-----DKDKKGPENKDPQTESQQLEAKAATPPNPSNPADSAGN 573

  Fly   430 L 430
            |
Mouse   574 L 574

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3356NP_611896.1 HECTc 766..1120 CDD:238033
HECTc 788..1119 CDD:214523
Bag3NP_038891.4 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..81
WW 23..55 CDD:197736
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 126..207
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 229..427
BAG 426..503 CDD:214591 12/53 (23%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 524..577 12/56 (21%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5021
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.