DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3356 and Wwtr1

DIOPT Version :9

Sequence 1:NP_611896.1 Gene:CG3356 / 37876 FlyBaseID:FBgn0034989 Length:1122 Species:Drosophila melanogaster
Sequence 2:NP_001020040.1 Gene:Wwtr1 / 295062 RGDID:1559609 Length:395 Species:Rattus norvegicus


Alignment Length:209 Identity:44/209 - (21%)
Similarity:65/209 - (31%) Gaps:74/209 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly   586 AEIIQMSKTLKDISMGLVELAFP---ETRSNLANYRKVLGHTE-----ADDKKLRHQKQIWANLL 642
            |.:.|.|..:.|      ||..|   |........|..|.|.|     .|.:|:.:|.....||.
  Rat   111 AHLRQQSYDVTD------ELPLPPGWEMTFTATGQRYFLNHIEKITTWQDPRKVMNQPLNHVNLH 169

  Fly   643 NVVV---------------FVLNQIHTRDLRLGFCPEDHWTVTRLDLPLDR-PTDL-----PLT- 685
            ..:.               ..:|..|.:.:.....|::|        |... ||.|     .|| 
  Rat   170 PTITSTSVPQRSMAVSQPNLAMNHQHQQVVATSLSPQNH--------PAQNPPTGLMSVPNALTT 226

  Fly   686 ---HSSRLRGIRPFQPIRDFTREDFE-----------------------NGPPMSTKQIRSITIL 724
               ...:|| ::..|..|:..|...|                       |.|.|:| .:||:|..
  Rat   227 QQQQQQKLR-LQRIQMERERIRMRQEELMRQEAALCRQLPMETETMAPVNTPAMNT-DMRSVTNS 289

  Fly   725 REIPFV--VPFNKR 736
            ...||:  .|::.|
  Rat   290 SSDPFLNGGPYHSR 303

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3356NP_611896.1 HECTc 766..1120 CDD:238033
HECTc 788..1119 CDD:214523
Wwtr1NP_001020040.1 WW 125..156 CDD:197736 7/30 (23%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5021
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.