DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3356 and Bag3

DIOPT Version :9

Sequence 1:NP_611896.1 Gene:CG3356 / 37876 FlyBaseID:FBgn0034989 Length:1122 Species:Drosophila melanogaster
Sequence 2:NP_001011936.1 Gene:Bag3 / 293524 RGDID:1307794 Length:574 Species:Rattus norvegicus


Alignment Length:129 Identity:29/129 - (22%)
Similarity:45/129 - (34%) Gaps:31/129 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly   326 GHKTTRMDSIFSSFLLNSLMVLD-------------RRQ--------LATLHQSPLLVIYVRLIA 369
            |.||.:...:...:|...|:.||             ||.        |..|.|..:.|.....:.
  Rat   446 GKKTDKKYLMIEEYLTKELLALDSVDPEGRADVRQARRDGVRKVQTILEKLEQKAIDVPGQVQVY 510

  Fly   370 EMMPNIL--QLPKSTLRGHANAPHRHRDGDDDSEESED---EDEELPAARTLDYDMEQTCRTSG 428
            |:.|:.|  :.|...:.|...|     |.|....|:||   |.::|.|......:...|..::|
  Rat   511 ELQPSNLEPEQPLQEIMGAVAA-----DKDKKGPENEDPQTESQQLEAKAATPPNPSSTADSAG 569

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3356NP_611896.1 HECTc 766..1120 CDD:238033
HECTc 788..1119 CDD:214523
Bag3NP_001011936.1 WW 23..55 CDD:197736
BAG 423..500 CDD:214591 12/53 (23%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5021
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.