DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3356 and Wwp2

DIOPT Version :9

Sequence 1:NP_611896.1 Gene:CG3356 / 37876 FlyBaseID:FBgn0034989 Length:1122 Species:Drosophila melanogaster
Sequence 2:NP_001099654.1 Gene:Wwp2 / 291999 RGDID:1310091 Length:870 Species:Rattus norvegicus


Alignment Length:370 Identity:121/370 - (32%)
Similarity:189/370 - (51%) Gaps:26/370 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly   762 PS-VLITVRRSHLYEDAYDKLRPDNEPDLRFKFRIQFVSSLGLDEAGIDGGGVFREFLSELIKTA 825
            || |.|:|.|..|:||::.::......|||   |..::...|  |.|:|.||:.||:...|....
  Rat   512 PSHVKISVSRQTLFEDSFQQIMNMKPYDLR---RRLYIIMRG--EEGLDYGGIAREWFFLLSHEV 571

  Fly   826 FDPNRGFFMVTTDNK--LYPNPNVADLFEDYEKHYYFIGRILGKSIYENLLVE----LPLAEFFL 884
            .:|....|.....|.  |..|| .:.:..|:..::.||||.:..::|....::    ||..:..|
  Rat   572 LNPMYCLFEYAGKNNYCLQINP-ASSINPDHLTYFRFIGRFIAMALYHGKFIDTGFTLPFYKRML 635

  Fly   885 TKLAGKYSDVDIHQLASLDPELYRNLLYLKDYSGDVSELNLDFTVASSSLGQTQIVELKPQGQSI 949
            .|..      .:..|.|:|||.|.:::::|:.:.|...|.|.|......||:....|||..|::|
  Rat   636 NKRP------TLRDLESIDPEFYNSIIWIKENNLDECGLELFFIQDMEILGKVTTHELKEGGENI 694

  Fly   950 PVTNSNRIEYLQLIADYKLNVQIRRHCNAFRKGLSNVLPIEWLYMFSNKELQILISGAEIPIDLE 1014
            .||..|:.||:.|:.|::....:.....||..|.:.|.|:|||..|..|||::::.|.: .||:.
  Rat   695 RVTEENKEEYIMLLTDWRFTRGVEEQTKAFLDGFNEVAPLEWLRYFDEKELELMLCGMQ-EIDMS 758

  Fly  1015 DLKKHCEYGGEFSPEHPSIVTFWEVLEGFDDMQRRQLLKFVTSCSRPPLLGFKDL-----DPPFF 1074
            |.:|:..| ..::.....|..||:|::..|:.:|.:||:|||...|.|:.||.:|     ...|.
  Rat   759 DWQKNAIY-RHYTKSSKQIQWFWQVVKEMDNEKRIRLLQFVTGTCRLPVGGFAELIGSNGPQKFC 822

  Fly  1075 IQNTGDMERLPTASTCTNLLKLPPFKTVEQMREKLLYAIQSGAGF 1119
            |...|....||.:.||.|.|.|||:|:.||::|||||||:...||
  Rat   823 IDRVGKETWLPRSHTCFNRLDLPPYKSYEQLKEKLLYAIEETEGF 867

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3356NP_611896.1 HECTc 766..1120 CDD:238033 118/365 (32%)
HECTc 788..1119 CDD:214523 110/341 (32%)
Wwp2NP_001099654.1 C2_E3_ubiquitin_ligase 17..142 CDD:175988
WW 302..331 CDD:278809
WW 332..361 CDD:278809
WW 407..435 CDD:278809
WW 447..477 CDD:238122
HECTc 516..868 CDD:238033 118/366 (32%)
HECTc 539..867 CDD:214523 110/341 (32%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5021
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.