DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3356 and Nedd4l

DIOPT Version :9

Sequence 1:NP_611896.1 Gene:CG3356 / 37876 FlyBaseID:FBgn0034989 Length:1122 Species:Drosophila melanogaster
Sequence 2:XP_038952600.1 Gene:Nedd4l / 291553 RGDID:735047 Length:1259 Species:Rattus norvegicus


Alignment Length:499 Identity:151/499 - (30%)
Similarity:247/499 - (49%) Gaps:68/499 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly   665 DH------WTVTRLDLPLD-------RPTDL-PL-----------------THSSRL----RGIR 694
            ||      |...||..|:.       .|.|| ||                 .|||::    ...|
  Rat   783 DHNTKTTTWEDPRLKFPVHMRSKASLNPNDLGPLPPGWEERIHLDGRTFYIDHSSQVLCGENDTR 847

  Fly   695 PFQPIRDFTREDFENGPPMSTKQIRSITILREIPFVVPFNKRVSILQSLVAASKMRVQGNMQAFL 759
            ...|:.|.....:|: |.:....|..    ..:|:...|.::....:     .|::...::....
  Rat   848 ESVPLYDSKITQWED-PRLQNPAITG----PAVPYSREFKQKYDYFR-----KKLKKPADIPNRF 902

  Fly   760 QGPSVLITVRRSHLYEDAYDKLRPDNEPD-LRFKFRIQFVSSLGLDEAGIDGGGVFREFLSELIK 823
            :     :.:.|::::|::|.::.....|| |:.:..|:|.|     |.|:|.|||.||:...|.|
  Rat   903 E-----MKLHRNNIFEESYRRIMSVKRPDVLKARLWIEFES-----EKGLDYGGVAREWFFLLSK 957

  Fly   824 TAFDPNRGFFMVT-TDN-KLYPNPNVADLFEDYEKHYYFIGRILGKSIYENLLVELPLAEFFLTK 886
            ..|:|..|.|..: ||| .|..|||.....||:..::.||||:.|.:::...|::......|...
  Rat   958 EMFNPYYGLFEYSATDNYTLQINPNSGLCNEDHLSYFTFIGRVAGLAVFHGKLLDGFFIRPFYKM 1022

  Fly   887 LAGKYSDVDIHQLASLDPELYRNLLYLKDYSGDVSELNLDFTVASSSLGQTQIVELKPQGQSIPV 951
            :.||  .:.::.:.|:|.|.|.:|.::.:  .|.:||:|.|.:...:.|||..|:|||.|..|.|
  Rat  1023 MLGK--QITLNDMESVDSEYYNSLKWILE--NDPTELDLMFCIDEENFGQTYQVDLKPNGSEIMV 1083

  Fly   952 TNSNRIEYLQLIADYKLNVQIRRHCNAFRKGLSNVLPIEWLYMFSNKELQILISGAEIPIDLEDL 1016
            ||.|:.||:.|:..::...::::..|||.:|.:.:|||:.:.:|...||::|:.|.. .:|:.|.
  Rat  1084 TNENKREYIDLVIQWRFVNRVQKQMNAFLEGFTELLPIDLIKIFDENELELLMCGLG-DVDVNDW 1147

  Fly  1017 KKHCEYGGEFSPEHPSIVTFWEVLEGFDDMQRRQLLKFVTSCSRPPLLGFKDL----DPPFF-IQ 1076
            ::|..|...:.|.||.|..||:.:...|..:|.:||:|||..||.|:.||.:|    .|..| |:
  Rat  1148 RQHSIYKNGYCPNHPVIQWFWKAVLLMDAEKRIRLLQFVTGTSRVPMNGFAELYGSNGPQLFTIE 1212

  Fly  1077 NTGDMERLPTASTCTNLLKLPPFKTVEQMREKLLYAIQSGAGFE 1120
            ..|..|:||.|.||.|.|.|||::|.|.:|||||.|:::..|||
  Rat  1213 QWGSPEKLPRAHTCFNRLDLPPYETFEDLREKLLMAVENAQGFE 1256

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3356NP_611896.1 HECTc 766..1120 CDD:238033 126/361 (35%)
HECTc 788..1119 CDD:214523 121/338 (36%)
Nedd4lXP_038952600.1 C2 <365..418 CDD:417471
WW 463..489 CDD:395320
WW 653..682 CDD:395320
WW 766..796 CDD:238122 3/12 (25%)
WW 815..865 CDD:197736 10/50 (20%)
HECTc 926..1255 CDD:214523 121/338 (36%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5021
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.