DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3356 and HERC4

DIOPT Version :9

Sequence 1:NP_611896.1 Gene:CG3356 / 37876 FlyBaseID:FBgn0034989 Length:1122 Species:Drosophila melanogaster
Sequence 2:XP_011537894.1 Gene:HERC4 / 26091 HGNCID:24521 Length:1081 Species:Homo sapiens


Alignment Length:668 Identity:178/668 - (26%)
Similarity:287/668 - (42%) Gaps:113/668 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly   507 FKLAAESTQLGFSAPLTLISKGVVPKHQGVDRTIPLLATFCMLFGRLLP----TLHDVEFVENKL 567
            ::.....:.:..:|...|..|.:.|.|..:.:.:.     ..|...|:|    :|.|||      
Human   473 YRTGTRFSGVDMNAARLLFHKLIQPDHPQISQQVA-----ASLEKNLIPKLTSSLPDVE------ 526

  Fly   568 LLQVHSTINHVRLM-----------PFSIAEIIQMSKT-LK-----------DISMGLVELAFPE 609
            .|:.:.|:....||           ||..| ::.:.|. ||           .:.:.:||| |.|
Human   527 ALRFYLTLPECPLMSDSNNFTTIAIPFGTA-LVNLEKAPLKVLENWWSVLEPPLFLKIVEL-FKE 589

  Fly   610 TRSNLANYRKVLGHTEADDKKLRHQKQIWANLLNVVVFVLNQIHTRDLRLG-FCPEDHWTVTRLD 673
            ...:|....|: |...:       :::|:.:.|:..:.||..:|..:.::| ....|.:.:..:.
Human   590 VVVHLLKLYKI-GIPPS-------ERRIFNSFLHTALKVLEILHRVNEKMGQIIQYDKFYIHEVQ 646

  Fly   674 LPLDRPTDLPLTHSSRLRGIRPFQPIRDFTREDFENGPPMSTKQIRSITILREIPFVV---PF-- 733
            ..:|...|.......:..|:            |..:|          :|.|.:||..:   ||  
Human   647 ELIDIRNDYINWVQQQAYGM------------DVNHG----------LTELADIPVTICTYPFVF 689

  Fly   734 --------NKRVSILQSLVAASKMRVQGNMQAFLQ-----GPSVLITVRRSHLYEDAYDKLRPDN 785
                    .:..::||..:|..:...|.....||.     .|.:::.|||.::..||.:.||...
Human   690 DAQAKTTLLQTDAVLQMQMAIDQAHRQNVSSLFLPVIESVNPCLILVVRRENIVGDAMEVLRKTK 754

  Fly   786 EPDLRFKFRIQFVSSLGLDEAGIDGGGVFREFLSELIKTAFDPNRGFFMVTTDNKL--YPNPNVA 848
            ..|.:...::.||.     |..:|.|||.:||...:::...||..|.|....|::|  :.:..  
Human   755 NIDYKKPLKVIFVG-----EDAVDAGGVRKEFFLLIMRELLDPKYGMFRYYEDSRLIWFSDKT-- 812

  Fly   849 DLFEDYEKHYYFIGRILGKSIYENLLVEL--PLAEFFLTKLAGKYSDVDIHQLASLDPELYRNLL 911
              |||.:. ::.||.|.|.:||...:|:|  |||.:  .||..|...:|  .|..|.|::.|::.
Human   813 --FEDSDL-FHLIGVICGLAIYNCTIVDLHFPLALY--KKLLKKKPSLD--DLKELMPDVGRSMQ 870

  Fly   912 YLKDY-SGDVSE-LNLDFTVASSSLGQTQIVELKPQGQSIPVTNSNRIEYLQLIADYKLNVQIRR 974
            .|.|| ..|:.| ..|:||:...:.|.|::.||...|....|...||.|::....||..|..:..
Human   871 QLLDYPEDDIEETFCLNFTITVENFGATEVKELVLNGADTAVNKQNRQEFVDAYVDYIFNKSVAS 935

  Fly   975 HCNAFRKGLSNVLPIEWLYMFSNKELQILISGAEIPIDLEDLKKHCEYGGEFSPEHPSIVTFWEV 1039
            ..:||..|...|...:.|.:|...|||.::.| ....|.::|:|:.||.||:..|||:|..||||
Human   936 LFDAFHAGFHKVCGGKVLLLFQPNELQAMVIG-NTNYDWKELEKNTEYKGEYWAEHPTIKIFWEV 999

  Fly  1040 LEGFDDMQRRQLLKFVTSCSRPPLLGFKDLDPPFFIQNTGDMER-LPTASTCTNLLKLPPFKTVE 1103
            .......:::|.|.|:|...|.|:||.|.|  ...||:||..|. ||.:.||.|||.||.:...|
Human  1000 FHELPLEKKKQFLLFLTGSDRIPILGMKSL--KLVIQSTGGGEEYLPVSHTCFNLLDLPKYTEKE 1062

  Fly  1104 QMREKLLYAIQSGAGFEL 1121
            .:|.||:.||....||.|
Human  1063 TLRSKLIQAIDHNEGFSL 1080

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3356NP_611896.1 HECTc 766..1120 CDD:238033 121/360 (34%)
HECTc 788..1119 CDD:214523 113/337 (34%)
HERC4XP_011537894.1 RCC1 2..368 CDD:332518
HECTc 733..1079 CDD:238033 121/362 (33%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5021
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.