DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3356 and MAGI3

DIOPT Version :9

Sequence 1:NP_611896.1 Gene:CG3356 / 37876 FlyBaseID:FBgn0034989 Length:1122 Species:Drosophila melanogaster
Sequence 2:NP_001136254.1 Gene:MAGI3 / 260425 HGNCID:29647 Length:1481 Species:Homo sapiens


Alignment Length:391 Identity:77/391 - (19%)
Similarity:140/391 - (35%) Gaps:117/391 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly   629 KKLRHQKQIWANLLNV----VVFVLNQIHT-RDLRL----GFCP-------------EDHWTVTR 671
            |::.||     |:.|:    ||.||.|... .|:.|    |..|             |:..::..
Human   620 KEIYHQ-----NVQNLTHLQVVEVLKQFPVGADVPLLILRGGPPSPTKTAKMKTDKKENAGSLEA 679

  Fly   672 LDLPLDRPTDLPLTHSSRLRGIRP-FQPIRDFTRED--FENGPPMSTKQIRSITILREIPF---- 729
            ::.|:.:|...|   .|.:|...| ..|...:.:..  :|:.|| :||.:......:|..|    
Human   680 INEPIPQPMPFP---PSIIRSGSPKLDPSEVYLKSKTLYEDKPP-NTKDLDVFLRKQESGFGFRV 740

  Fly   730 --------------VVPF-----NKRVSILQSLVAASKMRVQGN--------MQAFLQGPSVLIT 767
                          ::|.     :.|:.....|:....:.|:|.        |....:...||:|
Human   741 LGGDGPDQSIYIGAIIPLGAAEKDGRLRAADELMCIDGIPVKGKSHKQVLDLMTTAARNGHVLLT 805

  Fly   768 VRRSHLYEDAYDKLRPDNEPDLRFKFRIQFVS----SLGLDEAGIDGGGVFREFLSELIKTAFDP 828
            |||...|.:.    :|:::...      .|:|    |..|:.|.:......:|....:::...:.
Human   806 VRRKIFYGEK----QPEDDSSQ------AFISTQNGSPRLNRAEVPARPAPQEPYDVVLQRKENE 860

  Fly   829 NRGFFMVTTDNKLYPNPNVADLFEDYEKHYYFIGRILGKSIYENLLVELPLAEFFLTKLAGKYSD 893
            ..||.::|:.||  |.|.|..         :.|||::..|         |.......|:....|.
Human   861 GFGFVILTSKNK--PPPGVIP---------HKIGRVIEGS---------PADRCGKLKVGDHISA 905

  Fly   894 VDIHQLASLDPELYRNLLYLKDYSGDVSELNLDFTV-----------ASSSLGQTQIVELKPQGQ 947
            |:...:..|.   :.|::.|...:|    :.:..||           .::|..|:..::.:|.||
Human   906 VNGQSIVELS---HDNIVQLIKDAG----VTVTLTVIAEEEHHGPPSGTNSARQSPALQHRPMGQ 963

  Fly   948 S 948
            |
Human   964 S 964

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3356NP_611896.1 HECTc 766..1120 CDD:238033 40/198 (20%)
HECTc 788..1119 CDD:214523 34/176 (19%)
MAGI3NP_001136254.1 Interaction with ADRB1 and TGFA. /evidence=ECO:0000250 18..106
PDZ_signaling 24..101 CDD:238492
NK 123..>197 CDD:327404
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 182..273
WW 294..326 CDD:197736
WW 342..372 CDD:238122
Interaction with PTEN. /evidence=ECO:0000269|PubMed:10748157 410..492
PDZ 413..493 CDD:214570
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 542..570
PDZ 575..656 CDD:214570 12/40 (30%)
Interaction with ADGRB1. /evidence=ECO:0000269|PubMed:10748157 726..808 12/81 (15%)
PDZ_signaling 726..807 CDD:238492 11/80 (14%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 821..843 5/27 (19%)
PDZ_signaling 849..935 CDD:238492 21/112 (19%)
Interaction with LPAR2 and GRIN2B. /evidence=ECO:0000269|PubMed:10748157, ECO:0000269|PubMed:16904289 851..938 22/113 (19%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 939..976 6/26 (23%)
PDZ_signaling 1022..1100 CDD:238492
Red1 <1132..1461 CDD:311769
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1170..1481
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5021
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.