DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3356 and NEDD4L

DIOPT Version :9

Sequence 1:NP_611896.1 Gene:CG3356 / 37876 FlyBaseID:FBgn0034989 Length:1122 Species:Drosophila melanogaster
Sequence 2:XP_006722489.1 Gene:NEDD4L / 23327 HGNCID:7728 Length:1019 Species:Homo sapiens


Alignment Length:499 Identity:151/499 - (30%)
Similarity:246/499 - (49%) Gaps:68/499 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly   665 DH------WTVTRLDLPLD-------RPTDL-PL-----------------THSSRL----RGIR 694
            ||      |...||..|:.       .|.|| ||                 .|||::    ...|
Human   543 DHNTKTTTWEDPRLKFPVHMRSKTSLNPNDLGPLPPGWEERIHLDGRTFYIDHSSQVLCGENDTR 607

  Fly   695 PFQPIRDFTREDFENGPPMSTKQIRSITILREIPFVVPFNKRVSILQSLVAASKMRVQGNMQAFL 759
            ...|..|.....:|: |.:....|..    ..:|:...|.::....:     .|::...::....
Human   608 ESVPSYDSKITQWED-PRLQNPAITG----PAVPYSREFKQKYDYFR-----KKLKKPADIPNRF 662

  Fly   760 QGPSVLITVRRSHLYEDAYDKLRPDNEPD-LRFKFRIQFVSSLGLDEAGIDGGGVFREFLSELIK 823
            :     :.:.|::::|::|.::.....|| |:.:..|:|.|     |.|:|.|||.||:...|.|
Human   663 E-----MKLHRNNIFEESYRRIMSVKRPDVLKARLWIEFES-----EKGLDYGGVAREWFFLLSK 717

  Fly   824 TAFDPNRGFFMVT-TDN-KLYPNPNVADLFEDYEKHYYFIGRILGKSIYENLLVELPLAEFFLTK 886
            ..|:|..|.|..: ||| .|..|||.....||:..::.||||:.|.:::...|::......|...
Human   718 EMFNPYYGLFEYSATDNYTLQINPNSGLCNEDHLSYFTFIGRVAGLAVFHGKLLDGFFIRPFYKM 782

  Fly   887 LAGKYSDVDIHQLASLDPELYRNLLYLKDYSGDVSELNLDFTVASSSLGQTQIVELKPQGQSIPV 951
            :.||  .:.::.:.|:|.|.|.:|.::.:  .|.:||:|.|.:...:.|||..|:|||.|..|.|
Human   783 MLGK--QITLNDMESVDSEYYNSLKWILE--NDPTELDLMFCIDEENFGQTYQVDLKPNGSEIMV 843

  Fly   952 TNSNRIEYLQLIADYKLNVQIRRHCNAFRKGLSNVLPIEWLYMFSNKELQILISGAEIPIDLEDL 1016
            ||.|:.||:.|:..::...::::..|||.:|.:.:|||:.:.:|...||::|:.|.. .:|:.|.
Human   844 TNENKREYIDLVIQWRFVNRVQKQMNAFLEGFTELLPIDLIKIFDENELELLMCGLG-DVDVNDW 907

  Fly  1017 KKHCEYGGEFSPEHPSIVTFWEVLEGFDDMQRRQLLKFVTSCSRPPLLGFKDL----DPPFF-IQ 1076
            ::|..|...:.|.||.|..||:.:...|..:|.:||:|||..||.|:.||.:|    .|..| |:
Human   908 RQHSIYKNGYCPNHPVIQWFWKAVLLMDAEKRIRLLQFVTGTSRVPMNGFAELYGSNGPQLFTIE 972

  Fly  1077 NTGDMERLPTASTCTNLLKLPPFKTVEQMREKLLYAIQSGAGFE 1120
            ..|..|:||.|.||.|.|.|||::|.|.:|||||.|:::..|||
Human   973 QWGSPEKLPRAHTCFNRLDLPPYETFEDLREKLLMAVENAQGFE 1016

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3356NP_611896.1 HECTc 766..1120 CDD:238033 126/361 (35%)
HECTc 788..1119 CDD:214523 121/338 (36%)
NEDD4LXP_006722489.1 C2_NEDD4_NEDD4L 21..179 CDD:175999
WW 224..250 CDD:278809
WW 413..442 CDD:278809
WW 526..556 CDD:238122 3/12 (25%)
WW 575..625 CDD:197736 10/50 (20%)
HECTc 662..1016 CDD:238033 126/368 (34%)
HECTc 686..1015 CDD:214523 121/338 (36%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5021
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.