DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3356 and Nedd4

DIOPT Version :9

Sequence 1:NP_611896.1 Gene:CG3356 / 37876 FlyBaseID:FBgn0034989 Length:1122 Species:Drosophila melanogaster
Sequence 2:NP_001344927.1 Gene:Nedd4 / 17999 MGIID:97297 Length:1207 Species:Mus musculus


Alignment Length:365 Identity:118/365 - (32%)
Similarity:198/365 - (54%) Gaps:26/365 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly   768 VRRSHLYEDAYDKLRPDNEPD-LRFKFRIQFVSSLGLDEAGIDGGGVFREFLSELIKTAFDPNRG 831
            :||:::.||:|.::......| |:.:..|:|..     |.|:|.|||.||:...:.|..|:|..|
Mouse   854 LRRANILEDSYRRIMGVKRADLLKARLWIEFDG-----EKGLDYGGVAREWFFLISKEMFNPYYG 913

  Fly   832 FFMVT-TDN-KLYPNPNVADLFEDYEKHYYFIGRILGKSIYENLLVE----LPLAEFFLTKLAGK 890
            .|..: ||| .|..|||.....||:..::.||||:.|.::|...|::    .|..:..|.||   
Mouse   914 LFEYSATDNYTLQINPNSGLCNEDHLSYFKFIGRVAGMAVYHGKLLDGFFIRPFYKMMLQKL--- 975

  Fly   891 YSDVDIHQLASLDPELYRNLLYLKDYSGDVSELNLDFTVASSSLGQTQIVELKPQGQSIPVTNSN 955
               :.:|.:.|:|.|.|.:|.::.:  .|.:||:|.|.:.....|||...|||..|..|.|||.|
Mouse   976 ---ITLHDMESVDSEYYSSLRWILE--NDPTELDLRFIIDEELFGQTHQHELKTGGSEIVVTNKN 1035

  Fly   956 RIEYLQLIADYKLNVQIRRHCNAFRKGLSNVLPIEWLYMFSNKELQILISGAEIPIDLEDLKKHC 1020
            :.||:.|:..::...:|::...||::|...::|.:.:.:|...||::|:.|.. .:|:.|.::|.
Mouse  1036 KKEYIYLVIQWRFVNRIQKQMAAFKEGFFELIPQDLIKIFDENELELLMCGLG-DVDVNDWREHT 1099

  Fly  1021 EYGGEFSPEHPSIVTFWEVLEGFDDMQRRQLLKFVTSCSRPPLLGFKDL-----DPPFFIQNTGD 1080
            :|...:|..|..|..||:.:...|..:|.:||:|||..||.|:.||.:|     ...|.::..|.
Mouse  1100 KYKNGYSMNHQVIHWFWKAVWMMDSEKRIRLLQFVTGTSRVPMNGFAELYGSNGPQSFTVEQWGT 1164

  Fly  1081 MERLPTASTCTNLLKLPPFKTVEQMREKLLYAIQSGAGFE 1120
            .::||.|.||.|.|.|||:::.:::.:||..||::..||:
Mouse  1165 PDKLPRAHTCFNRLDLPPYESFDELWDKLQMAIENTQGFD 1204

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3356NP_611896.1 HECTc 766..1120 CDD:238033 117/363 (32%)
HECTc 788..1119 CDD:214523 111/342 (32%)
Nedd4NP_001344927.1 C2 <477..530 CDD:326325
WW 574..602 CDD:238122
WW 727..756 CDD:306827
WW 781..813 CDD:197736
HECTc 874..1203 CDD:214523 111/342 (32%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5021
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.