DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3356 and Gas7

DIOPT Version :9

Sequence 1:NP_611896.1 Gene:CG3356 / 37876 FlyBaseID:FBgn0034989 Length:1122 Species:Drosophila melanogaster
Sequence 2:XP_006532265.1 Gene:Gas7 / 14457 MGIID:1202388 Length:476 Species:Mus musculus


Alignment Length:129 Identity:30/129 - (23%)
Similarity:49/129 - (37%) Gaps:28/129 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    30 RKAALERQKRNELRQKENGAVVLQSYARSFIHRQRRKRAE-----REVFDIYLMGHKDGIVEDES 89
            |||..||||..|::.::. .:.|.:.....|.:.|||..:     ....|:|.........|..:
Mouse   340 RKALTERQKDLEMKTQQL-EIKLSNKTEEDIKKARRKSTQAGDDLMRCVDLYNQAQSKWFEEMVT 403

  Fly    90 LTFLLRRLNF------------FYSIREAKD--SERLIEVCQQILRQ--PARLLQHSSPDSLWL 137
            .|..|.||..            :..:|...|  ::..:|...|:||:  ||:      ...||:
Mouse   404 TTLELERLEVERVEMIRQHLCQYTQLRHETDMFNQSTVEPVDQLLRKVDPAK------DRELWV 461

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3356NP_611896.1 HECTc 766..1120 CDD:238033
HECTc 788..1119 CDD:214523
Gas7XP_006532265.1 SH3_GAS7 5..57 CDD:212763
WW_FCH_linker 109..201 CDD:374680
F-BAR_GAS7 214..446 CDD:153333 23/106 (22%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5021
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.