DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3356 and WWP1

DIOPT Version :9

Sequence 1:NP_611896.1 Gene:CG3356 / 37876 FlyBaseID:FBgn0034989 Length:1122 Species:Drosophila melanogaster
Sequence 2:NP_008944.1 Gene:WWP1 / 11059 HGNCID:17004 Length:922 Species:Homo sapiens


Alignment Length:455 Identity:131/455 - (28%)
Similarity:219/455 - (48%) Gaps:50/455 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly   683 PLTHSSRLR----GIRPF--QPIRDFTREDFENGPPMSTKQIRSITILREIPFVVPFNKRVSILQ 741
            ||.....:|    |:|.|  ...|..|.:|..||....||....|...|      .|..:::..:
Human   497 PLPEGWEIRYTREGVRYFVDHNTRTTTFKDPRNGKSSVTKGGPQIAYER------GFRWKLAHFR 555

  Fly   742 SLVAASKMRVQGNMQAFLQGPS-VLITVRRSHLYEDAYDKLRPDNEPDLRFKFRIQFVSSLGLDE 805
            .|..::.:            || |.|.|.|..|:||::.::......|||.:..:.|     ..|
Human   556 YLCQSNAL------------PSHVKINVSRQTLFEDSFQQIMALKPYDLRRRLYVIF-----RGE 603

  Fly   806 AGIDGGGVFREFLSELIKTAFDPNRGFFMVTTDNK--LYPNPNVADLFEDYEKHYYFIGRILGKS 868
            .|:|.||:.||:...|.....:|....|.....|.  |..|| .:.:..|:..::.||||.:..:
Human   604 EGLDYGGLAREWFFLLSHEVLNPMYCLFEYAGKNNYCLQINP-ASTINPDHLSYFCFIGRFIAMA 667

  Fly   869 IYENLLVE----LPLAEFFLTKLAGKYSDVDIHQLASLDPELYRNLLYLKDYSGDVSELNLDFTV 929
            ::....::    ||..:..|:|      .:.|..|.|:|.|.|.:|::::|.:.:...|.:.|:|
Human   668 LFHGKFIDTGFSLPFYKRMLSK------KLTIKDLESIDTEFYNSLIWIRDNNIEECGLEMYFSV 726

  Fly   930 ASSSLGQTQIVELKPQGQSIPVTNSNRIEYLQLIADYKLNVQIRRHCNAFRKGLSNVLPIEWLYM 994
            ....||:....:||..|.:|.||..|:.||:.|:.:::.:..::....||..|.:.|:|::||..
Human   727 DMEILGKVTSHDLKLGGSNILVTEENKDEYIGLMTEWRFSRGVQEQTKAFLDGFNEVVPLQWLQY 791

  Fly   995 FSNKELQILISGAEIPIDLEDLKKHCEYGGEFSPEHPSIVTFWEVLEGFDDMQRRQLLKFVTSCS 1059
            |..|||::::.|.: .:||.|.:::..| ..::.....|:.||:.::..|:..|.:||:|||...
Human   792 FDEKELEVMLCGMQ-EVDLADWQRNTVY-RHYTRNSKQIIWFWQFVKETDNEVRMRLLQFVTGTC 854

  Fly  1060 RPPLLGFKDL-----DPPFFIQNTGDMERLPTASTCTNLLKLPPFKTVEQMREKLLYAIQSGAGF 1119
            |.||.||.:|     ...|.|:..|....||.:.||.|.|.|||:|:.||::||||:||:...||
Human   855 RLPLGGFAELMGSNGPQKFCIEKVGKDTWLPRSHTCFNRLDLPPYKSYEQLKEKLLFAIEETEGF 919

  Fly  1120  1119
            Human   920  919

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3356NP_611896.1 HECTc 766..1120 CDD:238033 111/365 (30%)
HECTc 788..1119 CDD:214523 103/341 (30%)
WWP1NP_008944.1 C2_E3_ubiquitin_ligase 17..140 CDD:175988
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 210..388
HUL4 <307..922 CDD:227354 131/455 (29%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5021
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.