DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3356 and herc3

DIOPT Version :9

Sequence 1:NP_611896.1 Gene:CG3356 / 37876 FlyBaseID:FBgn0034989 Length:1122 Species:Drosophila melanogaster
Sequence 2:XP_002938676.3 Gene:herc3 / 100488790 XenbaseID:XB-GENE-968537 Length:1050 Species:Xenopus tropicalis


Alignment Length:666 Identity:166/666 - (24%)
Similarity:275/666 - (41%) Gaps:118/666 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly   535 GVDRTIPLLATFCMLF--------GRLLPTLHDVEFVENKLLLQVHSTINHVRLMP-----FSIA 586
            |:.:|:..||.:...|        .|..|.:..:.....|:|.:....::|.||:.     |...
 Frog   425 GIVQTLSSLACWNGSFLEKRNDEHFRTSPKIPGINMCSIKVLFEKLMNVHHSRLLEQILKGFESF 489

  Fly   587 EIIQMSKTLKDISMGLVELAFPE---------------------TRSNLANYRKVLGHTEADD-- 628
            .|.|:|.:..|:....:.:..||                     .|.: .|..|||.:..|..  
 Frog   490 LIPQLSSSPPDVEAMRIYIILPEFPLLQDSKYYITLTLPLAMAILRLD-TNPSKVLDNWWAQVCP 553

  Fly   629 ----KKLRHQKQIWANLLN-------VVVF---------VLNQIHTRDLRLGFCPEDHWTVTRLD 673
                |.:...|:....|||       .|:|         :|.::|..:.:......|.:.:..:.
 Frog   554 KYFLKLISLYKEAVVYLLNGRKTLLIPVLFTSYITAALKLLEKLHKVNGKAQHVEHDTFYIPEIS 618

  Fly   674 LPLDRPTDLPLTHSSRLRGIRPFQPIRDFTREDFENGPPMSTKQIRSITILREIPFVVPFNKRVS 738
            ..:|...|..:...:. .|::    :|....:|             ||| |...|||.....:..
 Frog   619 SLVDIQEDYLMWFLNE-AGLK----LRPTIMQD-------------SIT-LCSYPFVFDAQAKTK 664

  Fly   739 ILQSLVAASKMRVQ---GNMQ----------AFLQGPSVLITVRRSHLYEDAYDKLRPDNEPDLR 790
            :||: .|..:|:|.   .|:|          ..::.|.:::.|||:.|..||..:|...::.||:
 Frog   665 MLQT-DAELQMQVAINGANLQNVFMLLTLDPMLVKNPFLVLHVRRTSLVADALRELSIYSDIDLK 728

  Fly   791 FKFRIQFVSSLGLDEAGIDGGGVFREFLSELIKTAFDPNRGFFMVTTDNKLYPNPNVADLFED-- 853
            ...::.|..     |..:|.|||.:||...|:|...:|..|.|.|..|:.|.       .|.|  
 Frog   729 KPLKVIFDG-----EEAVDDGGVTKEFFLLLLKELLNPIYGMFTVYQDSNLL-------WFSDIC 781

  Fly   854 YEKHYYF--IGRILGKSIYENLLVELPLAEFFLTKLAGKYSDVD--IHQLASLDPELYRNLLYLK 914
            :.:|.:|  ||.:.|.:||...:|:|    :|...|..|..:|.  :..|..|.|...|:|..|.
 Frog   782 FVEHNWFHLIGIMCGLAIYNFTVVDL----YFPLALYKKLLNVQPTLEDLKELSPTEGRSLQELL 842

  Fly   915 DY-SGDVSEL-NLDFTVASSSLGQTQIVELKPQGQSIPVTNSNRIEYLQLIADYKLNVQIRRHCN 977
            || ..||.:: .|:||:...|.|..:...|...|..|.||..||.:::....:|..|..::....
 Frog   843 DYPEDDVDDVFCLNFTICRESYGLAERRPLVAGGDHITVTKDNRQQFVDAYVNYVFNQSVQEWYE 907

  Fly   978 AFRKGLSNVLPIEWLYMFSNKELQILISGAEIPIDLEDLKKHCEYGGEFSPEHPSIVTFWEVLEG 1042
            ||..|...|...:.|.:|...||:.::.|:. ..:.::|:::..|.|::|..||::..|||....
 Frog   908 AFSTGFLKVCGGKILELFQPSELRSMVVGSN-NYNWQELEENAIYKGDYSTAHPTVRMFWETFHD 971

  Fly  1043 FDDMQRRQLLKFVTSCSRPPLLGFKDLDPPFFIQNTGDME-RLPTASTCTNLLKLPPFKTVEQMR 1106
            |...::::.|.|:|...|.|:.|...|  ...||:....| .||.|.||.|||.||.:.:.|.:|
 Frog   972 FPLEKKKKFLLFLTGSDRIPIYGMSSL--RIIIQSISSGEDHLPVAHTCYNLLDLPKYSSKETLR 1034

  Fly  1107 EKLLYAIQSGAGFELS 1122
            .:|..||....||.|:
 Frog  1035 RRLTQAIDHYEGFSLA 1050

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3356NP_611896.1 HECTc 766..1120 CDD:238033 109/362 (30%)
HECTc 788..1119 CDD:214523 101/339 (30%)
herc3XP_002938676.3 RCC1 3..49 CDD:395335
ATS1 44..353 CDD:227511
HECTc 702..1048 CDD:238033 109/364 (30%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.