DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ocm and Tbx19

DIOPT Version :9

Sequence 1:NP_001188998.1 Gene:ocm / 37874 FlyBaseID:FBgn0266083 Length:2175 Species:Drosophila melanogaster
Sequence 2:NP_114394.1 Gene:Tbx19 / 83993 MGIID:1891158 Length:446 Species:Mus musculus


Alignment Length:262 Identity:64/262 - (24%)
Similarity:89/262 - (33%) Gaps:79/262 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly  1308 NEEILCI-IKWTNFLAAF----ESGFV-----FIWDVQMKTHNFLAATTTNLMPSVCGAIAVVNT 1362
            ||||..: ||:..|..||    |...:     .|.:.|..|::.|.....:....||.| |..|.
Mouse   197 NEEITALKIKYNPFAKAFLDAKERNHLKDVPEAISESQHVTYSHLGGWILSNPDGVCTA-ANSNY 260

  Fly  1363 KFA-----PDP----------------QALPLMARMLMN-----SMRNEKTNRLAVVMQGRQSFW 1401
            ::|     |.|                ||....|.|..|     ::....:|.|. |..|..| |
Mouse   261 QYATPLPLPAPHTHHGCEHYAGLRGHRQAPYPSAYMHRNHSPSVNLIESSSNNLQ-VFSGPDS-W 323

  Fly  1402 LVKGFLRHM------QGNACTKPTPMTHPLLTKKINVLCSLLVKQRVRENEKKTLGDGSGAPYEV 1460
            .......|.      ..|....|.|..:|.|.                     |:.:|.|.|  |
Mouse   324 TSLSSTPHASILSVPHSNGPINPGPSPYPCLW---------------------TISNGGGGP--V 365

  Fly  1461 LAG-DVSPQTS--LLMKNRSRDLKRKSQADERLLPSGPSMTKSSKPSAGGYPIAASVATSTTSAF 1522
            .:| :|...||  :|:.|.:      ..:...|||:  ..|.|:.....|.|...|:|.||.:|.
Mouse   366 ASGSEVHASTSGTILLGNPA------VTSPSSLLPT--QATTSAGVEVLGEPSLTSIAVSTWTAV 422

  Fly  1523 AS 1524
            ||
Mouse   423 AS 424

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ocmNP_001188998.1 DUF4801 771..821 CDD:292677
Tbx19NP_114394.1 TBOX 39..221 CDD:214656 10/23 (43%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167831467
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3585
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.830

Return to query results.
Submit another query.