DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ocm and EOMES

DIOPT Version :9

Sequence 1:NP_001188998.1 Gene:ocm / 37874 FlyBaseID:FBgn0266083 Length:2175 Species:Drosophila melanogaster
Sequence 2:NP_001265111.1 Gene:EOMES / 8320 HGNCID:3372 Length:705 Species:Homo sapiens


Alignment Length:477 Identity:86/477 - (18%)
Similarity:148/477 - (31%) Gaps:176/477 - (36%)


- Green bases have known domain annotations that are detailed below.


  Fly  1468 QTSLLMKNRSRDLKRKSQADERLLPSGPSMTKSSKPSAGGYPIAASVATSTTSAFASSSGKSTPV 1532
            ||.:::..:.|          |:.|..........|:| .|.:...|..:..:.:....||....
Human   284 QTEMIITKQGR----------RMFPFLSFNINGLNPTA-HYNVFVEVVLADPNHWRFQGGKWVTC 337

  Fly  1533 CTAKTNSASTK----NKSSATG---IRSNIEFRKV--------NHNDVDELQIPELHQTDHRWVV 1582
            ..|..|....|    .:|..||   :|..|.|.|:        |:|:...:.:..||:...|..:
Human   338 GKADNNMQGNKMYVHPESPNTGSHWMRQEISFGKLKLTNNKGANNNNTQMIVLQSLHKYQPRLHI 402

  Fly  1583 LDIFDD-FSHIFVPSFSDMISLTRIHSVMQVAEERQKVVKLQFFPNA-------PYDAFVTPSSK 1639
            :::.:| ...:..||.:...:.:....:...|.:...:.:|:...|.       .||:..|.|..
Human   403 VEVTEDGVEDLNEPSKTQTFTFSETQFIAVTAYQNTDITQLKIDHNPFAKGFRDNYDSMYTASEN 467

  Fly  1640 KKIYFGPLSLDMP-------------------PPVLVLLQSVDRKMMLREVYQREHSIPVQRHRR 1685
            .::  .|...|.|                   |.|..|.|:        ..|..|.::|      
Human   468 DRL--TPSPTDSPRSHQIVPGGRYGVQSFFPEPFVNTLPQA--------RYYNGERTVP------ 516

  Fly  1686 SMAFWVLQINGQVHFEIDTESTAKLAAQQKNAIGTP-----------PGLNVLKI---------- 1729
                   |.||            .|:.||...:..|           ||.|.|.|          
Human   517 -------QTNG------------LLSPQQSEEVANPPQRWLVTPVQQPGTNKLDISSYESEYTSS 562

  Fly  1730 ----------PSQLSVEIEKNQDEVPPVVVIDSDEEDDDG-------ERQL-------------V 1764
                      |.|.|..:....|...|.:.         |       :|::             |
Human   563 TLLPYGIKSLPLQTSHALGYYPDPTFPAMA---------GWGGRGSYQRKMAAGLPWTSRTSPTV 618

  Fly  1765 IDEQDDEQAETDVKQEVERTGFTIQTLPSSGAL---------------QITISDSAETSSHPAK- 1813
            ..|  |:.::..||:|:..:  .|:|.||..:|               :::.|:|:..:|...| 
Human   619 FSE--DQLSKEKVKEEIGSS--WIETPPSIKSLDSNDSGVYTSACKRRRLSPSNSSNENSPSIKC 679

  Fly  1814 -DVNTCHFS-------GGFMPF 1827
             |:|...:|       ||:..|
Human   680 EDINAEEYSKDTSKGMGGYYAF 701

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ocmNP_001188998.1 DUF4801 771..821 CDD:292677
EOMESNP_001265111.1 TBOX 267..460 CDD:238106 33/186 (18%)
T-box_assoc 482..703 CDD:292794 47/266 (18%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165141554
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3585
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.830

Return to query results.
Submit another query.