DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ocm and TBXT

DIOPT Version :9

Sequence 1:NP_001188998.1 Gene:ocm / 37874 FlyBaseID:FBgn0266083 Length:2175 Species:Drosophila melanogaster
Sequence 2:NP_001353214.1 Gene:TBXT / 6862 HGNCID:11515 Length:436 Species:Homo sapiens


Alignment Length:423 Identity:87/423 - (20%)
Similarity:131/423 - (30%) Gaps:152/423 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly  1626 PNAPYDAFVTPSSKKKIYFGPLSLDMPPPVLVLLQSVDRKM------MLREVYQREHSIPVQRHR 1684
            |.||...::.|.|..   ||  :..|..||......:..|:      ||..:::.|..|.:.|  
Human   117 PQAPSCVYIHPDSPN---FG--AHWMKAPVSFSKVKLTNKLNGGGQIMLNSLHKYEPRIHIVR-- 174

  Fly  1685 RSMAFWVLQING-----QVHFEIDTESTAKLAAQQKNAIGTPPGLNVLKIPSQLSVEIEKNQDEV 1744
                     :.|     ..|...:|:..|..|.|.:.       :..|||......:        
Human   175 ---------VGGPQRMITSHCFPETQFIAVTAYQNEE-------ITALKIKYNPFAK-------- 215

  Fly  1745 PPVVVIDSDEEDDDGERQLVIDEQDDEQAETDVKQEVERTGFTIQ---TLPSS------------ 1794
               ..:|:.|..|..|   :::|..|.|          :.|::..   .||.:            
Human   216 ---AFLDAKERSDHKE---MMEEPGDSQ----------QPGYSQSGGWLLPGTSTLCPPANPHPQ 264

  Fly  1795 --GALQITISDSAE---------TSSHPAKDVNTCHFSGGFMPFIANVPAKFGETAPTTQFLTP- 1847
              |||.:..:.|.:         :|.:|:                   |......:||....:| 
Human   265 FGGALSLPSTHSCDRYPTLRSHRSSPYPS-------------------PYAHRNNSPTYSDNSPA 310

  Fly  1848 -----QVQVTTSQSG----PETLTSSSSSHLPASKSAYPKINESLQELFSSGVPPGGITITKVDS 1903
                 |.....|..|    |..|..|.::..|.|.|.||    ||..:.:..|.||        |
Human   311 CLSMLQSHDNWSSLGMPAHPSMLPVSHNASPPTSSSQYP----SLWSVSNGAVTPG--------S 363

  Fly  1904 QEKTLPNETVQVVKNKKSIAITGIHKQVTKAASSTATVTAARAPVVKPQSTSVSKVAPPIRPGAT 1968
            |...:.|               |:..|..:  .|.|..|....||..|.|:     ..|:..||.
Human   364 QAAAVSN---------------GLGAQFFR--GSPAHYTPLTHPVSAPSSS-----GSPLYEGAA 406

  Fly  1969 TQPKTLVRLYPKPALAAGRKSLPANAKTPVATP 2001
            .....:...|  .|.|.||  |.| :.|||:.|
Human   407 AATDIVDSQY--DAAAQGR--LIA-SWTPVSPP 434

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ocmNP_001188998.1 DUF4801 771..821 CDD:292677
TBXTNP_001353214.1 T-box 44..219 CDD:307177 25/135 (19%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 280..309 5/47 (11%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165141546
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3585
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.830

Return to query results.
Submit another query.