DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ocm and Tbx20

DIOPT Version :9

Sequence 1:NP_001188998.1 Gene:ocm / 37874 FlyBaseID:FBgn0266083 Length:2175 Species:Drosophila melanogaster
Sequence 2:NP_919239.1 Gene:Tbx20 / 57246 MGIID:1888496 Length:445 Species:Mus musculus


Alignment Length:333 Identity:64/333 - (19%)
Similarity:119/333 - (35%) Gaps:100/333 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly  1862 TSSSSSHLPASKSAYPKINESLQELFSSGVPPGGITITKVDSQEKTLPNETVQVVK---NKKSIA 1923
            |:|....|.:..:|:     |:..|.|||.|           :||.....|::.::   .|.|.|
Mouse     4 TASPKPQLSSRANAF-----SIAALMSSGGP-----------KEKEAAENTIKPLEQFVEKSSCA 52

  Fly  1924 -----ITGI--HKQVTKAASSTATVTAARAPVVKP----QSTSVSKVAPPIRPGATTQPKTLVRL 1977
                 :|.:  |.:......|.::.:....|::..    .|..::|:|      .:.:.|.|...
Mouse    53 QPLGELTSLDAHAEFGGGGGSPSSSSLCTEPLIPTTPIIPSEEMAKIA------CSLETKELWDK 111

  Fly  1978 YPKPA-----LAAGRKSLPANAKTPVATPRQSQPVACDKPPLVSGSTLPALVEPSAR-------K 2030
            :.:..     ..:||:..|        |.|.|          .||      |:|.::       .
Mouse   112 FHELGTEMIITKSGRRMFP--------TIRVS----------FSG------VDPESKYIVLMDIV 152

  Fly  2031 SLPSKPLAAGEHLRPRQSLPAKVTANPPAAAR----PDAASTSAQ---NLTNVSKAQLAKEEI-C 2087
            .:.:|......|   |.|......|:||..||    ||:..|..|   .:.:..|.:|...|: .
Mouse   153 PVDNKRYRYAYH---RSSWLVAGKADPPLPARLYVHPDSPFTGEQLLKQMVSFEKVKLTNNELDQ 214

  Fly  2088 YGIMVAKDLPRFRAKVEGSDFMIKIPEHGVFRFKTFGLAASFLSRHVAKDPKLKQFLPAEWKFHP 2152
            :|.::...:.:::.:|.    :||..:|          .||.|:   .|..:.:.|:..|..|..
Mouse   215 HGHIILNSMHKYQPRVH----IIKKKDH----------TASLLN---LKSEEFRTFIFPETVFTA 262

  Fly  2153 LEQFNKQV 2160
            :..:..|:
Mouse   263 VTAYQNQL 270

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ocmNP_001188998.1 DUF4801 771..821 CDD:292677
Tbx20NP_919239.1 TBOX 98..290 CDD:238106 43/223 (19%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 318..337
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167831500
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3585
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11267
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.930

Return to query results.
Submit another query.