DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ocm and tbx22

DIOPT Version :9

Sequence 1:NP_001188998.1 Gene:ocm / 37874 FlyBaseID:FBgn0266083 Length:2175 Species:Drosophila melanogaster
Sequence 2:XP_005157203.1 Gene:tbx22 / 556143 ZFINID:ZDB-GENE-090626-2 Length:444 Species:Danio rerio


Alignment Length:250 Identity:49/250 - (19%)
Similarity:82/250 - (32%) Gaps:77/250 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly   775 NKPCSKDYCHLGCIC---ASLAGTELPVRDHC---------GRAECVLDC--RCLSAEESRVMRL 825
            :.|||.:......|.   ..|...||..|.|.         .|...:|.|  .|||   .|::.|
Zfish   157 DSPCSGENWMRQVISFDRVKLTNNELDDRGHIILKSMHKYRPRIHVILHCPPECLS---KRLLSL 218

  Fly   826 EAADGRGISNEDAFNLRRKATARLAKMEKDFTSTLVLTDNETLLINESQGDKKRRCTKAP--KRY 888
             .|||                        .||.:...|...|:...::|...|.:..:.|  |.:
Zfish   219 -PADG------------------------VFTFSFPETQFTTVTAYQNQQITKLKIDRNPFAKGF 258

  Fly   889 EDFDDSIYDE--EEKDVVSP----TTRKQKKHAAAAAAAAAAAAAAAAASAKISAPALSEP---- 943
            .:.:.::.|.  |.....||    .:...:.......::|:....:.:::..:...|.|.|    
Zfish   259 RERNGAVLDGILESYSWHSPFNGFKSLAMELQGRCFGSSASGITPSVSSAQAVHPTAFSSPQCCK 323

  Fly   944 -----CFVKDTDLAKLKHC------FVGLRRLSNVENLATF-------CMTHQLY 980
                 ||     ||...:|      :.|||.:.::..|.:.       |.:|.||
Zfish   324 ILPSSCF-----LAYRAYCSICLNNYTGLRPMLDLPLLTSLPVKKGDRCRSHWLY 373

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ocmNP_001188998.1 DUF4801 771..821 CDD:292677 15/59 (25%)
tbx22XP_005157203.1 TBOX 67..260 CDD:238106 28/130 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3585
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.