DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ocm and Tbx22

DIOPT Version :9

Sequence 1:NP_001188998.1 Gene:ocm / 37874 FlyBaseID:FBgn0266083 Length:2175 Species:Drosophila melanogaster
Sequence 2:XP_006257221.1 Gene:Tbx22 / 302369 RGDID:1589764 Length:533 Species:Rattus norvegicus


Alignment Length:172 Identity:38/172 - (22%)
Similarity:67/172 - (38%) Gaps:32/172 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly  1748 VVIDSDEEDDDGERQLVIDEQDDEQAETDVKQEVERTGFT-IQTLPSSGALQITISDSAETSSHP 1811
            |.:.::|.||.|  .:::......:....|.:|..|...: ||:.|:.|....:..::..|:...
  Rat   212 VKLTNNEMDDKG--HIILQSMHKYKPRVHVVEEDSRIDLSLIQSFPTEGVKTFSFKETEFTTVTA 274

  Fly  1812 AKD-------VNTCHFSGGFMPFIANVPAK-------FGETAPTTQFLTPQVQ--VTTSQSGPET 1860
            .::       ::...|:.||..     |.:       |.||.|.....|...:  |..:|:|   
  Rat   275 YQNQQITKLKIDRNPFAKGFRD-----PGRNRGVLDGFLETYPWRPSFTMDFKPFVPDTQNG--- 331

  Fly  1861 LTSSSSSHLPASKSAYPKINESLQELFSSG---VPPGGITIT 1899
              ||.||.:.:|..|...:|..|....|..   :||..|.:|
  Rat   332 --SSGSSPVTSSGGAPSPLNSLLSPSCSPPTVYIPPSSIGMT 371

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ocmNP_001188998.1 DUF4801 771..821 CDD:292677
Tbx22XP_006257221.1 TBOX 105..300 CDD:238106 17/94 (18%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166335210
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3585
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.830

Return to query results.
Submit another query.