DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ocm and Tbx2

DIOPT Version :9

Sequence 1:NP_001188998.1 Gene:ocm / 37874 FlyBaseID:FBgn0266083 Length:2175 Species:Drosophila melanogaster
Sequence 2:NP_033350.2 Gene:Tbx2 / 21385 MGIID:98494 Length:711 Species:Mus musculus


Alignment Length:366 Identity:74/366 - (20%)
Similarity:110/366 - (30%) Gaps:137/366 - (37%)


- Green bases have known domain annotations that are detailed below.


  Fly   916 AAAAAAAAAAAAAAAASAKISAPALSEPCFVKDTDLAKLKHCFVGLRRLSNVENLATFCMTHQLY 980
            |.||||||||||||.|...:||.....|.    ..|..||    .|.....||:           
Mouse    58 AGAAAAAAAAAAAAEAGLHVSALGPHPPA----AHLRSLK----SLEPEDEVED----------- 103

  Fly   981 KCFCGGDSPDGKPVVIEKDQWNAPVTHFNPDLAVRAHYSFERPPEETSTKKKGKEKKPKHK---- 1041
                     |.|..:..|:.|:                .|.:...|....|.|:...|..|    
Mouse   104 ---------DPKVTLEAKELWD----------------QFHKLGTEMVITKSGRRMFPPFKVRVS 143

  Fly  1042 -LESKSS----NDVADQKPQTQAVETLPLKTESKQEPP-PANSLFKDESP--------------- 1085
             |:.|:.    .|:...................|.:|. |.......:||               
Mouse   144 GLDKKAKYILLMDIVAADDCRYKFHNSRWMVAGKADPEMPKRMYIHPDSPATGEQWMAKPVAFHK 208

  Fly  1086 LKRSNELNKIFNYFRSRPDVCRRAISIPKNSYQRLNQRRADRVRHQIAREESLKTNEMLKMRIQG 1150
            ||.:|.::                   .|:.:..||.....:.|..|.|     .|::||:....
Mouse   209 LKLTNNIS-------------------DKHGFTILNSMHKYQPRFHIVR-----ANDILKLPYST 249

  Fly  1151 ------------AVVYYRKE------ID--------------RQRKRELSKKPVIEVRN------ 1177
                        ||..|:.:      ||              |:.||:....|.:.:..      
Mouse   250 FRTYVFPETDFIAVTAYQNDKITQLKIDNNPFAKGFRDTGNGRREKRKQLTLPTLRLYEEHCKPE 314

  Fly  1178 ----ESDAS--DASVRQKKIETPAEGPTPGKRIKLKADEPP 1212
                |||||  |....::...:|:..|:|.:..:.:|:|.|
Mouse   315 RDGAESDASSCDPPPAREPPPSPSAAPSPLRLHRARAEEKP 355

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ocmNP_001188998.1 DUF4801 771..821 CDD:292677
Tbx2NP_033350.2 TBOX 104..289 CDD:238106 35/224 (16%)
TBX 305..382 CDD:204975 12/51 (24%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 313..449 12/43 (28%)
Repression domain 1 (RD1). /evidence=ECO:0000250 518..602
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 640..687
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167831497
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3585
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.830

Return to query results.
Submit another query.