DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ocm and tbx-42

DIOPT Version :9

Sequence 1:NP_001188998.1 Gene:ocm / 37874 FlyBaseID:FBgn0266083 Length:2175 Species:Drosophila melanogaster
Sequence 2:NP_500749.1 Gene:tbx-42 / 190421 WormBaseID:WBGene00022000 Length:308 Species:Caenorhabditis elegans


Alignment Length:72 Identity:16/72 - (22%)
Similarity:31/72 - (43%) Gaps:17/72 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly  1854 SQSGPETLTSSSSSHLPASKSAYPKINESLQELFSSGVPPGGITITKVDSQEKTLPNETVQVVKN 1918
            |:.|.:..||.::..||:.:|:...:.:.:                 ||:.|.||..:|.|.:.|
 Worm   191 SEGGIKRKTSDAAGQLPSKRSSKKPVKKDV-----------------VDNSEVTLEVKTSQYLVN 238

  Fly  1919 KKSIAIT 1925
            :....:|
 Worm   239 QNESNLT 245

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ocmNP_001188998.1 DUF4801 771..821 CDD:292677
tbx-42NP_500749.1 T-box 9..190 CDD:279278
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3585
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.