powered by:
Protein Alignment ocm and tbx-42
DIOPT Version :9
Sequence 1: | NP_001188998.1 |
Gene: | ocm / 37874 |
FlyBaseID: | FBgn0266083 |
Length: | 2175 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_500749.1 |
Gene: | tbx-42 / 190421 |
WormBaseID: | WBGene00022000 |
Length: | 308 |
Species: | Caenorhabditis elegans |
Alignment Length: | 72 |
Identity: | 16/72 - (22%) |
Similarity: | 31/72 - (43%) |
Gaps: | 17/72 - (23%) |
- Green bases have known domain annotations that are detailed below.
Fly 1854 SQSGPETLTSSSSSHLPASKSAYPKINESLQELFSSGVPPGGITITKVDSQEKTLPNETVQVVKN 1918
|:.|.:..||.::..||:.:|:...:.:.: ||:.|.||..:|.|.:.|
Worm 191 SEGGIKRKTSDAAGQLPSKRSSKKPVKKDV-----------------VDNSEVTLEVKTSQYLVN 238
Fly 1919 KKSIAIT 1925
:....:|
Worm 239 QNESNLT 245
|
Known Domains:
Indicated by green bases in alignment.
Gene | Sequence | Domain | Region |
External ID | Identity |
ocm | NP_001188998.1 |
DUF4801 |
771..821 |
CDD:292677 |
|
tbx-42 | NP_500749.1 |
T-box |
9..190 |
CDD:279278 |
|
Blue background indicates that the domain is not in
the aligned region.
|
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
1 |
0.900 |
- |
- |
|
E1_KOG3585 |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
0 | 0.000 |
Not matched by this tool. |
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
1 | 0.900 |
|
Return to query results.
Submit another query.