DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ocm and tbx-38

DIOPT Version :9

Sequence 1:NP_001188998.1 Gene:ocm / 37874 FlyBaseID:FBgn0266083 Length:2175 Species:Drosophila melanogaster
Sequence 2:NP_499526.1 Gene:tbx-38 / 182861 WormBaseID:WBGene00006557 Length:303 Species:Caenorhabditis elegans


Alignment Length:233 Identity:51/233 - (21%)
Similarity:80/233 - (34%) Gaps:69/233 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly  1869 LPASKSAYPKINESLQELFSSGVPPGGITITK-----------VDSQEKTLPNETVQVVKNKKSI 1922
            ||.....:|:...:..|..|..|....|.||.           |.|..|.:|..||:.|::.|  
 Worm    87 LPIQYKEHPRGKRTGAEWMSEPVSFAHIKITNNPEIKDQKVILVQSMHKHIPVVTVKQVRHYK-- 149

  Fly  1923 AITGIH-----KQVTKAASSTATVTAARAPVVKPQSTSVSKVAPPIRPGATTQPKTLVRLYPKPA 1982
              ||..     :|....|:....|||.:..::|......:|.|...|                  
 Worm   150 --TGYQEDFSGEQFRLEATEFMVVTAYQNEILKNLKVHHNKFASGFR------------------ 194

  Fly  1983 LAAGRKSLPANAK-TPVATPRQSQPVACDKPPLVSGSTLPALVEPSARKSLPSKPLAAGEHLRPR 2046
             :.|::.|.:::: :..:.|::|:.|.   ||.:|    |.:       .||             
 Worm   195 -SNGKRRLSSDSENSENSPPKRSKLVT---PPTIS----PQI-------DLP------------- 231

  Fly  2047 QSLPAKVTAN--PPAAARPDAASTSAQNLTNVSKAQLA 2082
            |..|.....|  .|...:|..||....|....:.||||
 Worm   232 QQTPYYFNQNFVAPQNYQPQFASAQNYNFEVQNNAQLA 269

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ocmNP_001188998.1 DUF4801 771..821 CDD:292677
tbx-38NP_499526.1 TBOX 9..199 CDD:238106 29/134 (22%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3585
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.