DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ocm and tbx-34

DIOPT Version :9

Sequence 1:NP_001188998.1 Gene:ocm / 37874 FlyBaseID:FBgn0266083 Length:2175 Species:Drosophila melanogaster
Sequence 2:NP_499441.1 Gene:tbx-34 / 176549 WormBaseID:WBGene00006553 Length:302 Species:Caenorhabditis elegans


Alignment Length:377 Identity:65/377 - (17%)
Similarity:120/377 - (31%) Gaps:147/377 - (38%)


- Green bases have known domain annotations that are detailed below.


  Fly  1468 QTSLLMKNRSRDLKRKSQADERLLPSG-------PSMTKSSKPSAGGYPIAASVATSTTSAFASS 1525
            |.|::.:::.|:|:   ..:|.|:..|       |....|.......|.|...:..:....::..
 Worm     2 QVSIVNEHKYRELE---PLNEMLVKRGGVKMIPEPKFVISGLVDNEEYVIKLRIDLADEFRYSYQ 63

  Fly  1526 SGKSTPVCTAKTNS-------ASTKNKSSATGIRSNIEFRKV----NHNDVDELQIPELH-QTDH 1578
            :.:.||...:..||       ...:.::.||.....::|.|:    ..||:   |...:| :.:|
 Worm    64 NQQWTPFAPSTKNSKLSAITETEHRKETGATWNMRIVQFDKLLITREFNDI---QRNVIHVEPNH 125

  Fly  1579 RWV-VLDI------------FDDFSHIFVPSFSDMISLTRIHSVMQVAEERQKVVKLQFFPNAPY 1630
            ::: ||.|            |.....|.|.|:..                    .:::....||.
 Worm   126 KYIPVLTIQNVTTGKSTEFQFQQMEFIAVKSYQS--------------------ARIRHTKRAPR 170

  Fly  1631 DAFVTPSSKKK-------IYFGPL--SLDMPPPVLVLLQSVDRKMMLREVYQREHSIPVQRHRRS 1686
            ...:.|.|.:|       |...|.  ....|||                       .|.:     
 Worm   171 KMNLAPGSSQKPQLIVPDILHSPTYGFTAAPPP-----------------------FPFE----- 207

  Fly  1687 MAFWVL--QINGQV-----------------HFEIDTESTAKLAAQQKNAIGTPPGLNVLKIPSQ 1732
              :|:|  ||..|:                 |.:. ||::.::.|.:.       |.|.:.:|. 
 Worm   208 --YWLLYPQIQYQIQQLAYSLPMGPPMVPIHHIQC-TEASQRVYAPEY-------GWNSILMPG- 261

  Fly  1733 LSVEIEKNQDE---------VPPVVVIDSDEEDDDGERQLVIDEQDDEQAET 1775
                ..|.||:         .|         :|.:.|:..|:.||.::.:||
 Worm   262 ----AHKEQDDHYMFHHEIWAP---------QDHELEKLHVLTEQKNKPSET 300

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ocmNP_001188998.1 DUF4801 771..821 CDD:292677
tbx-34NP_499441.1 T-box 3..166 CDD:279278 30/188 (16%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3585
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.