DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ocm and sea-1

DIOPT Version :9

Sequence 1:NP_001188998.1 Gene:ocm / 37874 FlyBaseID:FBgn0266083 Length:2175 Species:Drosophila melanogaster
Sequence 2:NP_494611.1 Gene:sea-1 / 173710 WormBaseID:WBGene00004750 Length:376 Species:Caenorhabditis elegans


Alignment Length:396 Identity:71/396 - (17%)
Similarity:133/396 - (33%) Gaps:120/396 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly   825 LEAADGRGISNEDAFNLRRKATARLAKMEKDFTSTLVLTDNETLLINESQGDKKRRCTKAPKRYE 889
            |.|.....:|:....|....::..||..:..||..:||.|           :||:   |.|    
 Worm    50 LPAVSSELLSSSFPTNAPESSSRDLAPKQNQFTINVVLFD-----------EKKK---KNP---- 96

  Fly   890 DFDDSIYDEEEKDVVSPTTRKQKKHAAAAAAAAAAAAAAAAASAKI--SAPALSEPCF------- 945
              ::::....::.....:...|...::..:..|.:.....|.|..:  |:..|.:..|       
 Worm    97 --EENLPANGDQLATLRSLMMQINPSSPPSIPATSPQLPLAESENVPESSSTLKDHKFSLNTMLF 159

  Fly   946 -VKDTDLAKLKHCFVGLRRLSNVENLATFCMTHQL--------------------------YKCF 983
             ||..|..|:.        |:|.|..|.|   |::                          :|.:
 Worm   160 NVKKNDAVKIS--------LANQEQWAKF---HEIGTEMMVFNSGRRLFPLLAYKVSGLDPHKLY 213

  Fly   984 CGGDSPDGKPVVIEKDQWNAPVTHFNPDLAVRAHYSFERPPEETSTKKKGKEKKPKHKLESKSSN 1048
            |.|                   .|..||.|.:..|..:.........:|....||..::..:..|
 Worm   214 CAG-------------------VHMIPDSAYKQEYDHDLQQWVNCLNQKKTIFKPTSEILGRIEN 259

  Fly  1049 ---------DVADQKPQTQAV-ETLPLKTESKQEPPPANSLFKDESPLKRSNELNKIFNYFRSRP 1103
                     |::|.|....|: :..||:.|..::|    :|.|....|.:...|..|..|..|..
 Worm   260 GFKLMSLGIDMSDVKIFNIAIRKKTPLQIEKSRKP----NLDKTIEVLIQYKYLPVIKIYELSNS 320

  Fly  1104 DVCRRAI---SIPKNSYQRLNQRRADRVRHQIAREESLKT--NEMLKMRIQGAVVYYRKEIDRQR 1163
            .:.::.|   :.|:.|:..::..|..:::       .:||  |:..:..        ||:|..::
 Worm   321 GMEKKEIAQATFPETSFVTVSIYRNQKIK-------EMKTLGNKYCRTD--------RKQIVMEQ 370

  Fly  1164 KRELSK 1169
            :.||.:
 Worm   371 RGELEQ 376

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ocmNP_001188998.1 DUF4801 771..821 CDD:292677
sea-1NP_494611.1 TBOX 167..369 CDD:214656 44/250 (18%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160159250
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3585
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.830

Return to query results.
Submit another query.