DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ocm and mab-9

DIOPT Version :10

Sequence 1:NP_611894.1 Gene:ocm / 37874 FlyBaseID:FBgn0266083 Length:2175 Species:Drosophila melanogaster
Sequence 2:NP_493750.1 Gene:mab-9 / 173441 WormBaseID:WBGene00003106 Length:346 Species:Caenorhabditis elegans


Alignment Length:105 Identity:31/105 - (29%)
Similarity:40/105 - (38%) Gaps:29/105 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly   656 DRSFKE-EPNKLQEFTFREMLPPQPDAEIVACAEMISDMINTVAISCSENSFISEDPDALDASSV 719
            ||..|: ||.|...|:...:|....|.|.|..     |:               ||.|.:|.||:
 Worm     8 DRDDKDSEPVKKPRFSIANILDEVEDEEDVEV-----DV---------------EDVDDVDLSSI 52

  Fly   720 PKSSDLCPAKEETGKDTDKSGAKPK--NLPNKQKRLANEL 757
            |..|      .|..:...|.|.|.|  |||.:.|...:||
 Worm    53 PSKS------PERSRGRPKIGLKMKEGNLPIECKLEGSEL 86

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ocmNP_611894.1 MGA_dom 771..821 CDD:464998
PRK12323 <1933..>2053 CDD:481241
mab-9NP_493750.1 T-box 77..269 CDD:469628 3/10 (30%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.