DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ocm and mab-9

DIOPT Version :9

Sequence 1:NP_001188998.1 Gene:ocm / 37874 FlyBaseID:FBgn0266083 Length:2175 Species:Drosophila melanogaster
Sequence 2:NP_493750.1 Gene:mab-9 / 173441 WormBaseID:WBGene00003106 Length:346 Species:Caenorhabditis elegans


Alignment Length:105 Identity:31/105 - (29%)
Similarity:40/105 - (38%) Gaps:29/105 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly   656 DRSFKE-EPNKLQEFTFREMLPPQPDAEIVACAEMISDMINTVAISCSENSFISEDPDALDASSV 719
            ||..|: ||.|...|:...:|....|.|.|..     |:               ||.|.:|.||:
 Worm     8 DRDDKDSEPVKKPRFSIANILDEVEDEEDVEV-----DV---------------EDVDDVDLSSI 52

  Fly   720 PKSSDLCPAKEETGKDTDKSGAKPK--NLPNKQKRLANEL 757
            |..|      .|..:...|.|.|.|  |||.:.|...:||
 Worm    53 PSKS------PERSRGRPKIGLKMKEGNLPIECKLEGSEL 86

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ocmNP_001188998.1 DUF4801 771..821 CDD:292677
mab-9NP_493750.1 TBOX 76..272 CDD:238106 4/11 (36%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3585
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11267
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.000

Return to query results.
Submit another query.