DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ocm and tbx5b

DIOPT Version :9

Sequence 1:NP_001188998.1 Gene:ocm / 37874 FlyBaseID:FBgn0266083 Length:2175 Species:Drosophila melanogaster
Sequence 2:NP_001185700.1 Gene:tbx5b / 100004161 ZFINID:ZDB-GENE-060601-2 Length:422 Species:Danio rerio


Alignment Length:304 Identity:59/304 - (19%)
Similarity:93/304 - (30%) Gaps:107/304 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly    94 HWSKGLVNYYKKMGRIEEHEETEVYRVAEPLAAEELSKQMKQQ--LELLKTGKRS---------- 146
            ||.:.||: ::|:.....|        .:|.....|:...|.|  |.::|..:|:          
Zfish   146 HWMRQLVS-FQKLKLTNNH--------LDPFGHIILNSMHKYQPRLHIVKADERNSFGSSNTSFC 201

  Fly   147 LSLIEETTAIA-------EVPPKKPKQFPDITEEARVINDSDD----RLDAAPSKQ--------A 192
            .....|||.||       .:...|.:..|    .|:....:||    |:...|||:        |
Zfish   202 THSFAETTFIAVTSYQNHTITQLKIENNP----FAKGFRGNDDIELHRMSRTPSKEYPLVPRSTA 262

  Fly   193 AERTPTKSPAQVAASE----DVPTPATPSKEQSGQTSTCSSAEKTDKVEKVGGGSKFLDMLISKV 253
            .:|....||..::.||    ..|:|.....:.||..|...:....|....:              
Zfish   263 RQRAAPPSPDCLSRSEYTVTQKPSPGFTCSDTSGDQSLTETPSIHDPTYPL-------------- 313

  Fly   254 RVKNFARENNMPAEPSAVTFCTSEDEGSADFVGFDESVHQPGMLLTPLVPNNCKTTEGNSAFVSE 318
                |:.:.:....||::                |.:.|||.|.             |.|....|
Zfish   314 ----FSYQLSPDVAPSSM----------------DTTQHQPCMY-------------GGSQVGME 345

  Fly   319 SLDAYMREHHINDSDSQDDKDKLLEPMGHDGQVTSHSMPPPMDM 362
            .|    |....:||.:........|..|        :..||.|:
Zfish   346 EL----RWASYSDSTTYQSFSSAKEMSG--------TFVPPADL 377

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ocmNP_001188998.1 DUF4801 771..821 CDD:292677
tbx5bNP_001185700.1 TBOX 52..240 CDD:238106 21/106 (20%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170574533
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.