DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Nop60B and PUS4

DIOPT Version :9

Sequence 1:NP_001014547.1 Gene:Nop60B / 37873 FlyBaseID:FBgn0259937 Length:508 Species:Drosophila melanogaster
Sequence 2:NP_014107.1 Gene:PUS4 / 855424 SGDID:S000005236 Length:403 Species:Saccharomyces cerevisiae


Alignment Length:299 Identity:59/299 - (19%)
Similarity:103/299 - (34%) Gaps:121/299 - (40%)


- Green bases have known domain annotations that are detailed below.


  Fly   107 IKKILKVEKTGHSGTLDPKVTGCLIVCIDRATRLVKSQQSAG---KEYVAIFKL---HGAVESVA 165
            ::|:.|| |.||.|||||..:|.|::.|...|:.:.:..|..   .|..|:|.:   .|.||...
Yeast    60 LRKVSKV-KMGHGGTLDPLASGVLVIGIGAGTKKLANYLSGTVKVYESEALFGVSTTSGDVEGEI 123

  Fly   166 KVRQGL------------EKLRGALFQRPPLISAVK-----------------RQLRVR--TVYD 199
            ..:..:            ||..|.|.|.||:.:|:|                 |.:..|  |:||
Yeast   124 LSQNSVKHLNFDDLKTVEEKFVGQLKQTPPIYAALKMDGKPLHEYAREGKPLPRAIEPRQVTIYD 188

  Fly   200 SKLL--------DY-----------DETRNMGV-------------------------------- 213
            .|:.        ||           |..:|:..                                
Yeast   189 LKVFSDSLKRDHDYPLLRPTTEEAVDTVKNLNANMLNDVLYFSKEYTEKHGLDSEVAKVEEPFPL 253

  Fly   214 ---------------------FWVSCEAGSYIRTMCVHLGLVLGVGGQMLELRRVRSGIQS-ERD 256
                                 |..:..:|:|||::...:|..:.....|::|.|::....| |::
Yeast   254 SEQEEQEIQKEGDSYRAPKLHFKANVSSGTYIRSLVSDIGKSMRSSCYMVKLIRLQQQDWSLEKN 318

  Fly   257 GMVTMHDVLDAMWLYENHKDESMLRRVIKPL--EGLLVN 293
            .:..:.|..:        :||.:..:|::.:  ||..|:
Yeast   319 NVFQLTDFTE--------RDEKVWSKVLEKVLDEGATVD 349

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Nop60BNP_001014547.1 DKCLD 47..104 CDD:285330
CBF5 54..379 CDD:273073 59/299 (20%)
PseudoU_synth_hDyskerin 86..268 CDD:211338 53/270 (20%)
PUA 295..368 CDD:279774
PUS4NP_014107.1 PseudoU_synth_TruB_4 3..331 CDD:211344 53/279 (19%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0130
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100327
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.710

Return to query results.
Submit another query.