DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Nop60B and AT5G14460

DIOPT Version :9

Sequence 1:NP_001014547.1 Gene:Nop60B / 37873 FlyBaseID:FBgn0259937 Length:508 Species:Drosophila melanogaster
Sequence 2:NP_196950.2 Gene:AT5G14460 / 831297 AraportID:AT5G14460 Length:540 Species:Arabidopsis thaliana


Alignment Length:291 Identity:79/291 - (27%)
Similarity:125/291 - (42%) Gaps:66/291 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 KEKKKKKIKEEPLDGDDIGTLQKQGNFQI------KPSSK-IAELDTSQWPLLLKNFDKLNIRSN 65
            |||::||..|     ||:..:.::...|.      .|:.| :|.......|.|:       .|:.
plant   258 KEKEEKKKSE-----DDVVVVTEKKVEQFFKGLTKSPNEKGMASGGGDGEPFLV-------TRNG 310

  Fly    66 HYTPLAHGSSPLNRDIKEYMKTGFINL-DKPSNPSSHEVVAWIKKILKVEKTGHSGTLDPKVTGC 129
            ...|...|.:            |.:.| :||...:|..|...:::::||:|.||:|||||..||.
plant   311 ELPPRWDGPN------------GTVLLVNKPKGWTSFTVCGKLRRLVKVKKVGHAGTLDPMATGL 363

  Fly   130 LIVCIDRATRLVKSQQSAGKEYVAIFKLHGAVESV-----------------AKVRQGLEKLRGA 177
            ||||:.:||::|...|...|.|..:|:|..|..::                 ..:::.|....|.
plant   364 LIVCVGKATKVVDRYQGMIKGYSGVFRLGEATSTLDADSPVIQRESWEHIKDDDIKKALTSFLGE 428

  Fly   178 LFQRPPLISAVK--------RQLRVRTVYDS----KLLDYDETRNMG-----VFWVSCEAGSYIR 225
            ::|.||:.||:|        :..|..||..|    .:..:|..|::.     :|.|.|..|:|||
plant   429 IWQVPPMFSAIKVGGEKMYEKARRGETVELSPRRISIFQFDIERSLDDRQNLIFRVICSKGTYIR 493

  Fly   226 TMCVHLGLVLGVGGQMLELRRVRSGIQSERD 256
            ::|..|...||....:..|||...|..|..|
plant   494 SLCADLAKALGSCAHLTALRRDSIGEYSAND 524

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Nop60BNP_001014547.1 DKCLD 47..104 CDD:285330 10/57 (18%)
CBF5 54..379 CDD:273073 65/238 (27%)
PseudoU_synth_hDyskerin 86..268 CDD:211338 62/206 (30%)
PUA 295..368 CDD:279774
AT5G14460NP_196950.2 PseudoU_synth_EcTruB 323..534 CDD:211339 61/202 (30%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0130
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100327
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.710

Return to query results.
Submit another query.