DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Nop60B and trub2

DIOPT Version :9

Sequence 1:NP_001014547.1 Gene:Nop60B / 37873 FlyBaseID:FBgn0259937 Length:508 Species:Drosophila melanogaster
Sequence 2:NP_001002200.2 Gene:trub2 / 431747 ZFINID:ZDB-GENE-040704-41 Length:354 Species:Danio rerio


Alignment Length:222 Identity:39/222 - (17%)
Similarity:84/222 - (37%) Gaps:53/222 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    93 DKP--SNPSSHEVVAWIKKILKVEKTGHSGTLDPKVTGCLIVCIDRATRLVKS--QQSAGKEYVA 153
            |.|  :.|..|:|...:         ||  .||...:|.|::.:.:...::::  :....::|..
Zfish    83 DHPLVTGPQFHKVHVGV---------GH--RLDAFSSGVLVLGVGKGNSVLENLCKSHVTRDYTI 136

  Fly   154 IFKLHGAVESVAKVRQGLEK-----------------LRGALFQRPPLISAVKRQLRVRTVYD-- 199
            ..:...|.::.:...:.:||                 |:|:  .:..||:..:.:|:.:..|:  
Zfish   137 EGEFGKATDNFSHTGRVIEKTTYDHITHDKLERVLAMLQGS--NQKALITYSQVELQTQEAYELA 199

  Fly   200 SKLLDYDETRNMGVFW---------------VSC--EAGSYIRTMCVHLGLVLGVGGQMLELRRV 247
            ::.|.|.:.::..:..               |.|  |...|:|.:...:||.|.......::||.
Zfish   200 ARGLLYPDGKSPPILTGLRCIKFNPPHFTLEVRCVNETQKYLRKLIHEVGLELRASAVCTKVRRT 264

  Fly   248 RSGIQSERDGMVTMHDVLDAMWLYENH 274
            |.|.....:.:...|...|::....||
Zfish   265 RDGPFKVENALTRQHWTADSVLQAINH 291

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Nop60BNP_001014547.1 DKCLD 47..104 CDD:285330 4/12 (33%)
CBF5 54..379 CDD:273073 39/222 (18%)
PseudoU_synth_hDyskerin 86..268 CDD:211338 37/214 (17%)
PUA 295..368 CDD:279774
trub2NP_001002200.2 PseudoU_synth_hTruB2_like 16..289 CDD:211345 37/218 (17%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0130
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.