DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Nop60B and Trub2

DIOPT Version :9

Sequence 1:NP_001014547.1 Gene:Nop60B / 37873 FlyBaseID:FBgn0259937 Length:508 Species:Drosophila melanogaster
Sequence 2:NP_001014279.1 Gene:Trub2 / 366012 RGDID:1359394 Length:323 Species:Rattus norvegicus


Alignment Length:284 Identity:50/284 - (17%)
Similarity:95/284 - (33%) Gaps:92/284 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly    90 INLDKPSNPSSHEVVAWI---------KKI-----------------------LKVEKTGHSGTL 122
            :|..:||.|..|  |.::         ||:                       ||: ..||  .|
  Rat    38 LNAQQPSAPEQH--VRFLLGPVEGSEEKKLTLTATSVPSLTTHRLVRGPAFRNLKI-GVGH--RL 97

  Fly   123 DPKVTGCLIVCIDRATRLVKSQQSA--GKEYVAIFKLHGAVESVAKVRQGLEK------------ 173
            |.:.:|.|::.:.....|:.....|  .|:|.....|..|.::..:..|.:||            
  Rat    98 DVQASGVLVLAVGHGRSLLTDMYDAHLTKDYTVRGLLGKATDNFCEDGQLIEKTTYDHVTRERLD 162

  Fly   174 -----LRGALFQRPPLISAVKRQLRVRTVYDSKLLDYDETRN---MGVFWVSC------------ 218
                 ::|:  .:..|:......|:.:..|:..:.......|   |.:..:.|            
  Rat   163 RILAMIQGS--HQKALVMYSNLDLKSQEAYERAVQGVIRPMNKSPMLIAGIRCLHFAPPEFLLEV 225

  Fly   219 ----EAGSYIRTMCVHLGLVLGVGGQMLELRRVRSGIQSERDGMV----TMHDVLDAMWLYENHK 275
                |....:|.:...:||.|......:::||.|.|.....|.::    .:|.:.||:       
  Rat   226 QCMHETQQQLRRLVHEIGLELKTTAVCMQVRRTRDGFFGLDDALLRTQWDLHSIQDAI------- 283

  Fly   276 DESMLRRVIKPLE---GLLVNHKR 296
             ::...||.:.|.   .|:..|::
  Rat   284 -QTAAPRVARELRKNLSLMSGHQQ 306

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Nop60BNP_001014547.1 DKCLD 47..104 CDD:285330 5/13 (38%)
CBF5 54..379 CDD:273073 50/284 (18%)
PseudoU_synth_hDyskerin 86..268 CDD:211338 44/251 (18%)
PUA 295..368 CDD:279774 0/2 (0%)
Trub2NP_001014279.1 PseudoU_synth_hTruB2_like 11..283 CDD:211345 44/251 (18%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 302..323 1/5 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0130
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.