DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Nop60B and Trub1

DIOPT Version :9

Sequence 1:NP_001014547.1 Gene:Nop60B / 37873 FlyBaseID:FBgn0259937 Length:508 Species:Drosophila melanogaster
Sequence 2:XP_008758760.1 Gene:Trub1 / 361775 RGDID:1308502 Length:345 Species:Rattus norvegicus


Alignment Length:301 Identity:77/301 - (25%)
Similarity:117/301 - (38%) Gaps:78/301 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    87 TGFINLDKPSNPSSHEVV--------------------AWIKKILKVEKTGHSGTLDPKVTGCLI 131
            :|...:.||..|:|.|::                    .|.|:..:..|.||.||||....|.|:
  Rat    60 SGVFAVHKPKGPTSAELLNRLKEKLLAGTRPEAGLPSPEWNKRQKQTLKVGHGGTLDSAAQGVLV 124

  Fly   132 VCIDRATRLVKSQQSAGKEYVAIFKLHGA---VESVAKVRQG--------------LEKLRGALF 179
            |.|.|.|:::.|..|..|.|:|..:|..|   ::|..||.:.              |:|..|.:.
  Rat   125 VGIGRGTKMLTSMLSGSKRYIATGELGKATDTLDSTGKVTEEKPYDKITQEDIEGILQKFTGNIM 189

  Fly   180 QRPPLISAVK------------------RQLRVRTVYDSKLLDYDETRNMGVFW---VSCEAGSY 223
            |.|||.||:|                  |..|..||:...||.|...     |:   |.|..|.|
  Rat   190 QVPPLYSALKKDGQRLSTLMKRGETVEARPARPVTVHSISLLKYQPP-----FFTLDVECGGGFY 249

  Fly   224 IRTMCVHLGLVLGVGGQMLELRRVRSGIQSERDGMVTMHDVLDAMWLYENHKDESMLRRVIKPLE 288
            ||::...:|..|.....:|||.|.:.|     ...:..|.:.:..|...:      :.:.:|...
  Rat   250 IRSLVSDIGKELSSCATVLELTRTKQG-----PFTLAQHALPEDRWTIND------IAQSLKRCT 303

  Fly   289 GLL---VNHKRIIMKDSSVNAVCYGAKITLPGVLRYEDGIE 326
            .||   :..|:...:.||..|:..| .|||....|.:|.::
  Rat   304 SLLPEELTFKKSKSEPSSDQALSCG-YITLRETKREDDTVK 343

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Nop60BNP_001014547.1 DKCLD 47..104 CDD:285330 6/16 (38%)
CBF5 54..379 CDD:273073 77/301 (26%)
PseudoU_synth_hDyskerin 86..268 CDD:211338 63/238 (26%)
PUA 295..368 CDD:279774 10/32 (31%)
Trub1XP_008758760.1 PseudoU_synth 61..340 CDD:294089 76/295 (26%)
TruB 61..282 CDD:129523 62/230 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0130
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100327
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.710

Return to query results.
Submit another query.