DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Nop60B and Trub2

DIOPT Version :9

Sequence 1:NP_001014547.1 Gene:Nop60B / 37873 FlyBaseID:FBgn0259937 Length:508 Species:Drosophila melanogaster
Sequence 2:NP_663495.3 Gene:Trub2 / 227682 MGIID:2442186 Length:331 Species:Mus musculus


Alignment Length:194 Identity:33/194 - (17%)
Similarity:66/194 - (34%) Gaps:40/194 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly   115 KTGHSGTLDPKVTGCLIVCIDRATRLVKSQQSA--GKEYVAIFKLHGAVESVAK----------- 166
            |.|....||.:.:|.|::.:.....|:.....|  .|:|.....|..|.::..:           
Mouse    90 KIGVGHRLDVQASGVLVLAVGHGRSLLTDMYDAHLTKDYTVRGLLGKATDNFCEDGRLIEKTTYD 154

  Fly   167 --VRQGLEKLRGAL--FQRPPLISAVKRQLRVRTVYDSKLLDYDETRNMGVFWVS---------- 217
              .|:.|:::...:  ..:..|:......|:.:..|:..:.......|.....:|          
Mouse   155 HVTRERLDRILAVIQGSHQKALVMYSNLDLKSQEAYEMAVQGVIRPMNKSPMLISGIRCLHFAPP 219

  Fly   218 -------C--EAGSYIRTMCVHLGLVLGVGGQMLELRRVRSGIQSERDGMV----TMHDVLDAM 268
                   |  |....:|.:...:||.|.......::||.|.|.....|.::    .:|::.||:
Mouse   220 EFLLEVQCMHETQQQLRKLVHEIGLELKTSAVCTQVRRTRDGFFGLDDALLRTQWDLHNIQDAI 283

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Nop60BNP_001014547.1 DKCLD 47..104 CDD:285330
CBF5 54..379 CDD:273073 33/194 (17%)
PseudoU_synth_hDyskerin 86..268 CDD:211338 32/192 (17%)
PUA 295..368 CDD:279774
Trub2NP_663495.3 PseudoU_synth_hTruB2_like 11..283 CDD:211345 32/192 (17%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 309..331
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0130
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.