DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Nop60B and TRUB1

DIOPT Version :9

Sequence 1:NP_001014547.1 Gene:Nop60B / 37873 FlyBaseID:FBgn0259937 Length:508 Species:Drosophila melanogaster
Sequence 2:NP_631908.1 Gene:TRUB1 / 142940 HGNCID:16060 Length:349 Species:Homo sapiens


Alignment Length:218 Identity:59/218 - (27%)
Similarity:86/218 - (39%) Gaps:59/218 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    87 TGFINLDKPSNPSSHEVV----------------AWIKKILKVEKTGHSGTLDPKVTGCLIVCID 135
            :|...:.||..|:|.|::                .|.|:..:..|.||.||||....|.|:|.|.
Human    69 SGVFAVHKPKGPTSAELLNRLKEKLLAEAGMPSPEWTKRKKQTLKIGHGGTLDSAARGVLVVGIG 133

  Fly   136 RATRLVKSQQSAGKEYVAIFKLHGAVESV------------AKVRQG-----LEKLRGALFQRPP 183
            ..|:::.|..|..|.|.||.:|..|.:::            .|:.|.     |:|..|.:.|.||
Human   134 SGTKMLTSMLSGSKRYTAIGELGKATDTLDSTGRVTEEKPYDKITQEDIEGILQKFTGNIMQVPP 198

  Fly   184 LISAVKRQ------------------LRVRTVYDSKLLDYDETRNMGVFW---VSCEAGSYIRTM 227
            |.||:|:.                  .|..|||...|..:...     |:   |.|..|.|||::
Human   199 LYSALKKDGQRLSTLMKRGEVVEAKPARPVTVYSISLQKFQPP-----FFTLDVECGGGFYIRSL 258

  Fly   228 CVHLGLVLGVGGQMLELRRVRSG 250
            ...:|..|.....:|||.|.:.|
Human   259 VSDIGKELSSCANVLELTRTKQG 281

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Nop60BNP_001014547.1 DKCLD 47..104 CDD:285330 6/16 (38%)
CBF5 54..379 CDD:273073 59/218 (27%)
PseudoU_synth_hDyskerin 86..268 CDD:211338 59/218 (27%)
PUA 295..368 CDD:279774
TRUB1NP_631908.1 PseudoU_synth_TruB_4 70..348 CDD:211344 59/217 (27%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0130
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100327
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.710

Return to query results.
Submit another query.