DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment mRpS17 and RPS11A

DIOPT Version :10

Sequence 1:NP_525119.1 Gene:mRpS17 / 37872 FlyBaseID:FBgn0034986 Length:155 Species:Drosophila melanogaster
Sequence 2:NP_010308.3 Gene:RPS11A / 851589 SGDID:S000002432 Length:156 Species:Saccharomyces cerevisiae


Alignment Length:80 Identity:19/80 - (23%)
Similarity:33/80 - (41%) Gaps:2/80 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MSRRGLLLMGQCMPCIKQNASKIRIRRMELDKNLNMYFKKDEFYFAH-DPQKVCKTGDVVLIREL 64
            :|.||.:|.|..:.........||...:......|.|.|:.:....| .|....:.||:|.:.:.
Yeast    64 VSIRGKILTGTVVSTKMHRTIVIRRAYLHYIPKYNRYEKRHKNVPVHVSPAFRVQVGDIVTVGQC 128

  Fly    65 PERLTRLITHNVEKV 79
             ..:::.:..||.||
Yeast   129 -RPISKTVRFNVVKV 142

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
mRpS17NP_525119.1 Ribosomal_uS17 <22..79 CDD:466775 12/57 (21%)
RPS11ANP_010308.3 PTZ00241 4..156 CDD:240326 19/80 (24%)

Return to query results.
Submit another query.