DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment mRpS17 and AT3G18880

DIOPT Version :10

Sequence 1:NP_525119.1 Gene:mRpS17 / 37872 FlyBaseID:FBgn0034986 Length:155 Species:Drosophila melanogaster
Sequence 2:NP_188518.1 Gene:AT3G18880 / 821421 AraportID:AT3G18880 Length:105 Species:Arabidopsis thaliana


Alignment Length:59 Identity:14/59 - (23%)
Similarity:28/59 - (47%) Gaps:3/59 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly    23 IRIRRMELDKNLNMYFKKDEFYFAHDPQKVCKTGDVVLI---RELPERLTRLITHNVEK 78
            :.:.|:..:...|.|.|:...:.|||.:..|..||.|.:   |.|.:....:::..::|
plant    19 VAVDRLFHNNIYNRYVKRTSKFMAHDEKDSCNIGDRVKLDPSRPLSKHKHWIVSEIIKK 77

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
mRpS17NP_525119.1 Ribosomal_uS17 <22..79 CDD:466775 14/59 (24%)
AT3G18880NP_188518.1 Ribosomal_uS17 2..74 CDD:466775 13/54 (24%)

Return to query results.
Submit another query.